Gene Information

Name : walR (CAR_c00240)
Accession : YP_004373791.1
Strain : Carnobacterium sp. 17-4
Genome accession: NC_015391
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 24160 - 24867 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
TTGAAAAAAATATTAGTAGTTGATGATGAGAAACCAATTTCAGATATCGTTAAATTTAATTTAACAAAAGAAGGATATGA
AGTGTTTACGGCATATGATGGAGAAGAAGCTTTAGAAAAAGTAGAAGAAGTATTGCCAGATCTTATCATTTTAGACTTGA
TGCTTCCTAAAAAAGATGGGTTAGAAGTTTGTCGTGAAGTCCGAAAAAATCATGATATGCCTATTATCATGGTTACAGCA
AAAGACTCGGAAATTGATAAAGTACTTGGATTAGAACTTGGTGCGGATGACTATGTCACAAAACCATTTTCTAATAGAGA
ATTGACAGCACGTGTAAAAGCAAATTTAAGAAGACATGATAATGCTAAGACGCCAGTTGTTGAAGAAATTGAAACAAATG
ATATTGAAGTAGGTGCTTTAACGATTCATCCAGATGCGTACATTGTGTCTAAAAGAGGAGCCACAATTGAATTAACGCAC
CGCGAATTTGAATTGCTGCATTATTTGGCTAAACATTTAGGTCAAGTAATGACCAGAGAACATTTGTTACAAACGGTTTG
GGGCTACGATTATTTTGGAGACGTAAGAACGGTCGATGTAACGGTTAGAAGATTAAGAGAAAAAATAGAAGACAACCCTA
GTCACCCAACTTGGCTTGTAACAAGACGTGGAGTTGGCTATTATTTAAGAAATCCCGAACAGGAGTAA

Protein sequence :
MKKILVVDDEKPISDIVKFNLTKEGYEVFTAYDGEEALEKVEEVLPDLIILDLMLPKKDGLEVCREVRKNHDMPIIMVTA
KDSEIDKVLGLELGADDYVTKPFSNRELTARVKANLRRHDNAKTPVVEEIETNDIEVGALTIHPDAYIVSKRGATIELTH
REFELLHYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPTWLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-28 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_004373791.1 two-component response regulator NC_012469.1.7685629. Protein 2e-60 69
walR YP_004373791.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-48 57
walR YP_004373791.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-48 57
walR YP_004373791.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-48 57
walR YP_004373791.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-48 57
walR YP_004373791.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-48 57
walR YP_004373791.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-48 57
walR YP_004373791.1 two-component response regulator NC_003923.1003749.p0 Protein 6e-48 57
walR YP_004373791.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-48 57
walR YP_004373791.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-48 57
walR YP_004373791.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-48 57
walR YP_004373791.1 two-component response regulator HE999704.1.gene2815. Protein 3e-39 52
walR YP_004373791.1 two-component response regulator NC_012469.1.7686381. Protein 1e-34 48
walR YP_004373791.1 two-component response regulator AE016830.1.gene1681. Protein 2e-38 47
walR YP_004373791.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-32 46
walR YP_004373791.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-31 45
walR YP_004373791.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-30 45
walR YP_004373791.1 two-component response regulator AE000516.2.gene3505. Protein 3e-28 45
walR YP_004373791.1 two-component response regulator HE999704.1.gene1528. Protein 2e-24 44
walR YP_004373791.1 two-component response regulator CP000647.1.gene4257. Protein 3e-32 44
walR YP_004373791.1 two-component response regulator CP000034.1.gene3834. Protein 2e-31 44
walR YP_004373791.1 two-component response regulator CP001138.1.gene4273. Protein 1e-31 44
walR YP_004373791.1 two-component response regulator BAC0533 Protein 3e-32 44
walR YP_004373791.1 two-component response regulator NC_002695.1.915041.p Protein 2e-31 44
walR YP_004373791.1 two-component response regulator CP001918.1.gene5135. Protein 6e-27 44
walR YP_004373791.1 two-component response regulator NC_010410.6002989.p0 Protein 3e-24 44
walR YP_004373791.1 two-component response regulator NC_010400.5986590.p0 Protein 2e-23 44
walR YP_004373791.1 two-component response regulator NC_011595.7057856.p0 Protein 3e-24 44
walR YP_004373791.1 two-component response regulator CP000034.1.gene2186. Protein 7e-25 44
walR YP_004373791.1 two-component response regulator CP001138.1.gene2239. Protein 1e-23 44
walR YP_004373791.1 two-component response regulator NC_002695.1.916589.p Protein 6e-25 44
walR YP_004373791.1 two-component response regulator BAC0039 Protein 7e-25 44
walR YP_004373791.1 two-component response regulator BAC0596 Protein 1e-23 44
walR YP_004373791.1 two-component response regulator AF162694.1.orf4.gene Protein 9e-29 43
walR YP_004373791.1 two-component response regulator CP004022.1.gene3215. Protein 3e-30 43
walR YP_004373791.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-32 43
walR YP_004373791.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-32 43
walR YP_004373791.1 two-component response regulator AF130997.1.orf0.gene Protein 6e-32 43
walR YP_004373791.1 two-component response regulator AM180355.1.gene1830. Protein 2e-33 43
walR YP_004373791.1 two-component response regulator CP001918.1.gene3444. Protein 6e-24 43
walR YP_004373791.1 two-component response regulator AE015929.1.gene1106. Protein 3e-25 42
walR YP_004373791.1 two-component response regulator CP001485.1.gene721.p Protein 1e-21 41
walR YP_004373791.1 two-component response regulator EU250284.1.orf4.gene Protein 1e-28 41
walR YP_004373791.1 two-component response regulator DQ212986.1.gene4.p01 Protein 3e-32 41
walR YP_004373791.1 two-component response regulator CP000647.1.gene2531. Protein 8e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_004373791.1 two-component response regulator VFG1389 Protein 2e-25 43
walR YP_004373791.1 two-component response regulator VFG1563 Protein 1e-28 41
walR YP_004373791.1 two-component response regulator VFG1702 Protein 4e-28 41