Gene Information

Name : yclJ (CAR_c16880)
Accession : YP_004375362.1
Strain : Carnobacterium sp. 17-4
Genome accession: NC_015391
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1757658 - 1758362 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGATTGAAGACAATCAATCCGTATGCGAAATGATGGAAATGTTTTTCATGAAAGAAGAATGGAAGGCAACTTTTGTCCA
AGACGGTAAAGAAGGATTAGATGCTTTTCTAAATGATTCCGAAAATTGGGATTTAATTACTTTAGATTTAAATTTACCAA
GTATGGACGGTATGCAAATTTGTCGTGAGATACGCAAAGTTTCAAAAACAATACCAATTATTATGTTAACAGCTAAAGAT
TCTGAAAGCGATCAAGTCATTGGACTAGAAATTGGTGCGGATGATTATGTTACAAAACCATTTAGTCCGTTAACTTTAAT
TGCTCGTATAAAAGCTTTATATCGTCGAGTAGATTTGATTCATGATGAGGCCGGTAAAGTAGATGAGAAAGCATATGAAG
TGGAAACGAAGTACCTTAAAATGGATAAGAGAACGCGTGAAGCCATTTTGTATGATAAATCCATCGACAGTTTGACGCCA
AAAGAATTTGAGTTGCTTTATACACTAGCTAAAAGTCCTAAGCAAGTTTTTTCTAGAGAGCAACTCCTAACGATTGTTTG
GGATTATGAGTACTTTGGAGATGAGCGAACAGTGGATGCTCACATCAAAAAATTACGCCAAAAAATTGATAAAACGGGCC
CACAAGTGATTCAAACTGTTTGGGGAATAGGGTATAAATATGATGATTCTGGAGTCTCCTCATGA

Protein sequence :
MIEDNQSVCEMMEMFFMKEEWKATFVQDGKEGLDAFLNDSENWDLITLDLNLPSMDGMQICREIRKVSKTIPIIMLTAKD
SESDQVIGLEIGADDYVTKPFSPLTLIARIKALYRRVDLIHDEAGKVDEKAYEVETKYLKMDKRTREAILYDKSIDSLTP
KEFELLYTLAKSPKQVFSREQLLTIVWDYEYFGDERTVDAHIKKLRQKIDKTGPQVIQTVWGIGYKYDDSGVSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-38 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_004375362.1 two-component response regulator NC_012469.1.7685629. Protein 2e-39 48
yclJ YP_004375362.1 two-component response regulator HE999704.1.gene1528. Protein 1e-25 43
yclJ YP_004375362.1 two-component response regulator FJ349556.1.orf0.gene Protein 7e-35 43
yclJ YP_004375362.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-35 43
yclJ YP_004375362.1 two-component response regulator NC_002758.1121668.p0 Protein 8e-36 43
yclJ YP_004375362.1 two-component response regulator NC_009641.5332272.p0 Protein 8e-36 43
yclJ YP_004375362.1 two-component response regulator NC_013450.8614421.p0 Protein 8e-36 43
yclJ YP_004375362.1 two-component response regulator NC_007793.3914279.p0 Protein 8e-36 43
yclJ YP_004375362.1 two-component response regulator NC_003923.1003749.p0 Protein 9e-36 43
yclJ YP_004375362.1 two-component response regulator NC_002745.1124361.p0 Protein 8e-36 43
yclJ YP_004375362.1 two-component response regulator NC_009782.5559369.p0 Protein 8e-36 43
yclJ YP_004375362.1 two-component response regulator NC_002951.3237708.p0 Protein 8e-36 43
yclJ YP_004375362.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-35 43
yclJ YP_004375362.1 two-component response regulator HE999704.1.gene2815. Protein 5e-37 42
yclJ YP_004375362.1 two-component response regulator AF155139.2.orf0.gene Protein 7e-34 42
yclJ YP_004375362.1 two-component response regulator NC_005054.2598277.p0 Protein 2e-29 42
yclJ YP_004375362.1 two-component response regulator NC_014475.1.orf0.gen Protein 2e-29 42
yclJ YP_004375362.1 two-component response regulator AE016830.1.gene1681. Protein 1e-34 42
yclJ YP_004375362.1 two-component response regulator BAC0596 Protein 6e-28 42
yclJ YP_004375362.1 two-component response regulator CP001138.1.gene2239. Protein 6e-28 42
yclJ YP_004375362.1 two-component response regulator AE000516.2.gene3505. Protein 1e-29 41
yclJ YP_004375362.1 two-component response regulator AM180355.1.gene1830. Protein 2e-29 41
yclJ YP_004375362.1 two-component response regulator NC_002695.1.916589.p Protein 1e-27 41
yclJ YP_004375362.1 two-component response regulator BAC0039 Protein 1e-27 41
yclJ YP_004375362.1 two-component response regulator CP000034.1.gene2186. Protein 1e-27 41
yclJ YP_004375362.1 two-component response regulator CP004022.1.gene1676. Protein 5e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_004375362.1 two-component response regulator VFG1563 Protein 1e-37 43
yclJ YP_004375362.1 two-component response regulator VFG1702 Protein 3e-38 43