Gene Information

Name : Marky_0243 (Marky_0243)
Accession : YP_004367114.1
Strain : Marinithermus hydrothermalis DSM 14884
Genome accession: NC_015387
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 237300 - 237965 bp
Length : 666 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: msv:Mesil_0142 two component transcriptional regulator, winged helix family; PFAM: Signal transduction r

DNA sequence :
ATGGCTAGGGTACTGGTGGTGGATGACGACCCCGCGATCCGGGAGGTGCTTGCGGCCTACCTCGCCCGTGAGCGCTTCGA
GGTCCTGGAGGCAGAGGACGGCCTGCAGGCCCTTGAGCAGGCCCCCGGAGCGGACCTGGTGATCCTGGATCTGATGCTGC
CCGGGATGGATGGGTGGCGCGTGGCCCAGGAGTTGCGGCGCGACTGGCCGGACCTCCCGATCTTGATGCTGACCGCGCGG
GGGGAGGAGGAGGAGCGCGTGCGGGGGTTTGAGCTCGGCGCGGACGATTACGTGACCAAGCCCTTCAGCCCCCGCGAGGT
CGTGGCGCGCGTCAGGGCCTTGTTGCGGCGGGTGGGGTTGAAGGACGAGCTCGTCTACGGCCCCCTCGTGATCCGCCCCA
GGGCCCGCGAGGTTCTGCTCGAGGGGCAGCCGGTCGCCTTGAGCCGGCTCGAGTTCGACCTGCTCCTCACCCTGGCGCGC
CATCCCGGGATGGTCTTCACGCGGGAGCGGCTGTTGGAGCGCGTGTGGGGGCCGGGGTTCGAGGGGGTGGACCGGGTGGT
GGATGTGCACGTCGCTTTGTTGCGCAAGAAGCTCGGGGACGATGCGGAGCACCCCCGGTTCATCGAGACTGTGCGCGGGG
TGGGGTACCGGTTTCGGGAGTCGTAG

Protein sequence :
MARVLVVDDDPAIREVLAAYLARERFEVLEAEDGLQALEQAPGADLVILDLMLPGMDGWRVAQELRRDWPDLPILMLTAR
GEEEERVRGFELGADDYVTKPFSPREVVARVRALLRRVGLKDELVYGPLVIRPRAREVLLEGQPVALSRLEFDLLLTLAR
HPGMVFTRERLLERVWGPGFEGVDRVVDVHVALLRKKLGDDAEHPRFIETVRGVGYRFRES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-26 44
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-24 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-24 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-30 48
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-34 47
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-29 46
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 3e-26 44
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 3e-26 44
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-34 44
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-29 44
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-29 44
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 5e-25 43
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-18 43
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-26 42
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-21 42
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 2e-20 41
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family BAC0111 Protein 7e-21 41
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family VFG1386 Protein 7e-25 45
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family VFG1390 Protein 7e-26 42
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family VFG1563 Protein 2e-24 42
Marky_0243 YP_004367114.1 two component transcriptional regulator, winged helix family VFG1702 Protein 3e-24 42