Gene Information

Name : bgla_2g09560 (bgla_2g09560)
Accession : YP_004348927.1
Strain :
Genome accession: NC_015376
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1202347 - 1203078 bp
Length : 732 bp
Strand : +
Note : -

DNA sequence :
ATGGACCCACAGAAACGCATCCTGATCGTCGAAGACGATGCCGATATCGCCGAGGTGCTCGCGCTGCACCTGCGCGACGA
GCGCTACGAGGTGGTGCACTGCGCCAACGGCGACGACGGCCTGCGCCGCCTCGAGCAGGGCAACTGGGACGCGCTGATCC
TGGACCTGATGCTGCCCGGCGTCGACGGCCTGGAGATCTGCCGCCGGGCGCGCGCGATGGAGCGCTACACGCCGATCATC
ATCATCAGCGCGCGTTCGAGCGAGGTGCACCGGATCCTCGGCCTCGAGCTGGGCGCCGACGACTACCTCGCCAAGCCGTT
CTCGATGCTGGAGCTGGTGGCGCGCGTGAAGGCGCTGCTGCGGCGCGTCGAGGCGCTGTCGCGCGACACGCGCTCGGAGG
CGGGGCGCGTCGACGTGGGCGGCCTCACGCTCGATCCGCTCACGCGCGAGGCGGCGGTGGACGGCGCGGCGATCGACCTG
ACGCCGCGCGAATTCGACCTGCTGTACCACTTCGCCCGCCATCCCGGCAAGGCCTTCTCGCGCACCGACCTGCTCAATGC
CGTATGGGGCTACCAGCACGAAGGCTACGAACACACCGTGAATACCCACATCAACCGGCTGCGCGCCAAGATCGAGGCCG
ATCCGGCCCAGCCGGCGCGGATCCTGACCGTCTGGGGGCGCGGCTACAAGCTGGTCGCGCCGGGCCCGGCCGAAGCCGGC
AAGGACGCCTGA

Protein sequence :
MDPQKRILIVEDDADIAEVLALHLRDERYEVVHCANGDDGLRRLEQGNWDALILDLMLPGVDGLEICRRARAMERYTPII
IISARSSEVHRILGLELGADDYLAKPFSMLELVARVKALLRRVEALSRDTRSEAGRVDVGGLTLDPLTREAAVDGAAIDL
TPREFDLLYHFARHPGKAFSRTDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPARILTVWGRGYKLVAPGPAEAG
KDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-67 59
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-66 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_012469.1.7685629. Protein 2e-45 45
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_013450.8614146.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_002951.3238224.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_007793.3914065.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_002758.1121390.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_010079.5776364.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_002952.2859858.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_007622.3794948.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_003923.1003417.p0 Protein 3e-37 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein AF155139.2.orf0.gene Protein 2e-42 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein AE000516.2.gene3505. Protein 8e-38 42
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein HE999704.1.gene1528. Protein 2e-32 41
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein NC_012469.1.7686381. Protein 2e-38 41
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein HE999704.1.gene2815. Protein 7e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein VFG1563 Protein 5e-67 59
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein VFG1702 Protein 5e-67 59
bgla_2g09560 YP_004348927.1 Two component transcriptional regulator, winged helix family protein VFG1389 Protein 4e-32 44