Gene Information

Name : bgla_2g14630 (bgla_2g14630)
Accession : YP_004349421.1
Strain :
Genome accession: NC_015376
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1832594 - 1833289 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :

ATGAAAGTATTGATCGTCGAAGACGAACCGAAGGTCGTCGATTACCTGAAGAGCGGGCTGTCGGAGGAAGGCTGGGTGGT
CGACACCGCCACCGACGGCGAGGACGGCGCCTGGAAGGCCGTCGAATACGACTACGACGTGGTCGTGCTGGACGTGATGC
TGCCGAAGATCGACGGCTTCGGCGTGTTGCGCGCGCTGCGCGCGCAGAAGGACACGCCGGTCATCATGCTGACCGCGCGC
GACCGCGTCGACGACCGCGTGCGCGGCCTGCGCGGCGGCGCCGACGACTACCTGACCAAGCCCTTCTCCTTCCTCGAGCT
GATCGAGCGGCTGCGCGCGCTGACGCGCCGCGCGCGCGTGCAGGAATCGACGCTGATCTCGATCGGCGACCTGCGGGTCG
ACCTGATCAGCCGCCGCGCCACCCGCAACGGCATCCGCCTGGACCTGACCGCCCAGGAATTCCAACTGCTCGGCGTGCTG
GCGCGCCGGCGCGGCGAGGTGCTGTCGAAGACCACCATCACCGAGCTGGTCTGGGACGTCAATTTCGACAGCAACGCCAA
CGTGGTGGAAACCGCCATCAAGCGTCTGCGGGCCAAGCTCGACGGCCCGTTCTCCGACAAACTGCTGCATACCATCCGCG
GGATGGGATACGTGCTCGAGGTCCGCGACGAGCCCGAACCCGACCTGCGCCGCTGA

Protein sequence :

MKVLIVEDEPKVVDYLKSGLSEEGWVVDTATDGEDGAWKAVEYDYDVVVLDVMLPKIDGFGVLRALRAQKDTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLISRRATRNGIRLDLTAQEFQLLGVL
ARRRGEVLSKTTITELVWDVNFDSNANVVETAIKRLRAKLDGPFSDKLLHTIRGMGYVLEVRDEPEPDLRR

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
copR	NP_460069.2	transcriptional regulatory protein YedW	Not tested	SPI-5	Protein	1e-35	51
copR	AAC33719.1	regulatory protein CopR	Not tested	SPI-5	Protein	2e-34	50

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	BAC0083	Protein	3e-42	57
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	BAC0125	Protein	3e-47	57
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	BAC0197	Protein	3e-43	54
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	BAC0638	Protein	1e-33	54
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	BAC0111	Protein	7e-42	50
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	BAC0308	Protein	2e-41	50
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	BAC0347	Protein	5e-37	47
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_010079.5776364.p0	Protein	5e-26	41
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_002952.2859858.p0	Protein	5e-26	41
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_007622.3794948.p0	Protein	5e-26	41
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_003923.1003417.p0	Protein	5e-26	41
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_013450.8614146.p0	Protein	5e-26	41
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_002951.3238224.p0	Protein	5e-26	41
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_007793.3914065.p0	Protein	5e-26	41
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	NC_002758.1121390.p0	Protein	5e-26	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	VFG0596	Protein	6e-36	51
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	VFG1389	Protein	2e-28	48
bgla_2g14630	YP_004349421.1	two component heavy metal response transcriptional regulator, winged helix family protein	VFG1386	Protein	4e-24	43