Gene Information

Name : bgla_2g10250 (bgla_2g10250)
Accession : YP_004348990.1
Strain :
Genome accession: NC_015376
Putative virulence/resistance : Virulence
Product : ferric enterobactin transport ATP-binding protein FepC
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1120
EC number : -
Position : 1283837 - 1284688 bp
Length : 852 bp
Strand : -
Note : -

DNA sequence :
ATGAACGGCCGCGACGCGCAACAGCCCGCCGCGTGCCGGGAAGAAGGCCTGCGCGCGGTCGACCTGAGCCTGCACTATCC
CGGCGGCGCGCCGATCATCGCGCATCTCGACGTGGCGATCGCGCCGCATGCGTTCACCACCATCGTCGGGCCCAACGGCT
GCGGGAAGTCGACCCTGCTGAAGGCGCTGAGCCGCGTGCTGAGCCCGCAGGGCGGCGCGGTGCTGCTGGACGGGCGCGAG
GCCGCCGGCTACGCGCCGAAGGCCTATGCGCGCCAGGTCGGCTTCCTGCCGCAATCCTCGACGGCACCCGAGGGCATCAC
GGTCGCCGAGCTGGTGGCGCGCGGGCGCTATCCCCATCAATCGCTGCTGCAGTGGACCAGCGAGGCGGATCGCGCCGCGG
TGCGCGAGGCGATGGCGCGCACCGACGTGGCCGAGCTGGCCGGGCGGCGCGTGGCGGAGCTGTCGGGCGGGCAGCGCCAG
CGCGTCTGGATCGCGATGGCGCTGGCCCAGCAGACCGAGATCCTGCTGCTCGACGAGCCCACCACCTATCTCGACCTGGC
GCACCAGATCGACGTGCTCGAACTCTGTCACGAGCTGAACACGCGCTTCGGCACCACCGTGGTGGCCGTGCTGCACGACC
TGAACGAGGCCTGCCGGTATGCCGACCGGATCATCATGATGAAGGACGGCCGGATCGTCACCAGTGGCGAGCCGGGCGCG
GCGATCACGCCGGCCACCGTCCGCGAGGCCTTCGGGCTGGAGGTGCGCGTGATCGAGGATCCCGTCACGGGCACGCCGCT
GGTGCTGCCGCTCAGGGCCGGCAAGCGGCGCGGCGCGGCAGCGGCGGCCTGA

Protein sequence :
MNGRDAQQPAACREEGLRAVDLSLHYPGGAPIIAHLDVAIAPHAFTTIVGPNGCGKSTLLKALSRVLSPQGGAVLLDGRE
AAGYAPKAYARQVGFLPQSSTAPEGITVAELVARGRYPHQSLLQWTSEADRAAVREAMARTDVAELAGRRVAELSGGQRQ
RVWIAMALAQQTEILLLDEPTTYLDLAHQIDVLELCHELNTRFGTTVVAVLHDLNEACRYADRIIMMKDGRIVTSGEPGA
AITPATVREAFGLEVRVIEDPVTGTPLVLPLRAGKRRGAAAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iusE YP_005143742.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 6e-58 51
fagC YP_005680307.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 9e-59 48
fagC YP_003782430.1 ABC transporter ATP-binding protein Not tested PiCp 1 Protein 9e-59 48
fagC YP_005682397.1 ATP binding cytoplasmic membrane protein Virulence PiCp 1 Protein 9e-59 48
fagC YP_005684488.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 9e-59 48
fecE AAL08451.1 ATP-binding protein FecE Virulence SRL Protein 8e-50 46
SPN23F_09560 YP_002510939.1 ferric siderophore ABC transporter ATP-binding protein Virulence PPI-1 Protein 1e-57 44
SP_1035 NP_345510.1 iron-compound ABC transporter ATP-binding protein Not tested PPI-1 Protein 1e-57 44
ciuD YP_005685432.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-52 43
ciuD YP_005681255.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-52 43
ciuD YP_005683346.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-52 43
ciuD YP_003783391.1 iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 3e-52 43
DIP0585 NP_938961.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 2e-50 42
CDCE8392_1767 YP_005134301.1 iron complex transport system ATP-binding protein Virulence Not named Protein 2e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_2g10250 YP_004348990.1 ferric enterobactin transport ATP-binding protein FepC BAC0164 Protein 5e-50 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bgla_2g10250 YP_004348990.1 ferric enterobactin transport ATP-binding protein FepC VFG0925 Protein 5e-63 54
bgla_2g10250 YP_004348990.1 ferric enterobactin transport ATP-binding protein FepC VFG1042 Protein 4e-50 46