Gene Information

Name : Psed_0785 (Psed_0785)
Accession : YP_004330895.1
Strain : Pseudonocardia dioxanivorans CB1190
Genome accession: NC_015312
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 836208 - 836909 bp
Length : 702 bp
Strand : +
Note : KEGG: sen:SACE_0761 two-component system response regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence :
ATGCGAATCCTCGTCGTGGACGACGACCGGGCCGTCCGTGAGTCACTGCGGCGCTCGCTCGCGTTCAACGGCTACACCGT
CGAGCTCGCGGGCGACGGCCAGGCCGCCCTCGACGCGCTCCAGGCCTCGCGCCCCGACGCGATGGTCCTCGACGTGATGA
TGCCGCGGCTCGACGGCCTCGAGGTCTGCCGACGGATGCGTGCCGCGGGCGACGAGCTGCCGATCCTCGTCCTCACCGCC
CGCGACGCGGTGTCCGACCGGGTGGCCGGGCTCGACGCCGGCGCCGACGACTACCTGCCGAAGCCGTTCGCGCTGGAGGA
GCTGCTGGCGCGGCTGCGGGCGTTGCTGCGCAGGCGCACGCCCGACGAGATCGCGGCGGCCGCCGCGGGTGCGAGCAAAC
CGCTGGAGTTCGCCGACCTGTCGCTGGACCCCGACACCCGTGACGTCCGCCGCGGCGACCGGCCGATCAGCCTGACCCGC
ACCGAGTTCTCGCTGCTGGAGCTGCTCCTCGCGCACCCACGCCGGGTGCTGACCCGCGCGCAGATCCTCGAGCAGGTCTG
GGGCTACGACTTCCCGACCACCGGCAACGCGCTCGAGGTCTACATCGGCTACCTGCGTCGCAAGACGGAGGCGGGCGGCG
AGCCCCGGCTCATCCACACCGTCCGCGGGGTCGGCTACGTGCTGCGCGAGTCGCCGCCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLAFNGYTVELAGDGQAALDALQASRPDAMVLDVMMPRLDGLEVCRRMRAAGDELPILVLTA
RDAVSDRVAGLDAGADDYLPKPFALEELLARLRALLRRRTPDEIAAAAAGASKPLEFADLSLDPDTRDVRRGDRPISLTR
TEFSLLELLLAHPRRVLTRAQILEQVWGYDFPTTGNALEVYIGYLRRKTEAGGEPRLIHTVRGVGYVLRESPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-28 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-29 45
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-31 45
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-35 44
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-24 44
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-31 43
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-28 42
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-26 42
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-28 42
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-30 41
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-74 78
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-41 52
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-42 49
Psed_0785 YP_004330895.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-28 42