Gene Information

Name : Marme_0627 (Marme_0627)
Accession : YP_004311756.1
Strain : Marinomonas mediterranea MMB-1
Genome accession: NC_015276
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 657721 - 658083 bp
Length : 363 bp
Strand : +
Note : PFAM: transposase (), IS66 Orf2-like; KEGG: aac:Aaci_3053 IS66 Orf2 family protein

DNA sequence :
ATGTTTACATCCTCTCCCCAAGTTTCTATTACCTTGATTTGTGGCCCAACCGATATGCGTAAAGCCATTGATGGCTTATG
TGACGTGGTGGCCTATGACCTAGAGCAGGACCCCTGCTCTGAGCACTTATTTGTCTTCTGCGGTCGTACTCGTAATAAAC
TCAAGATTTTACAATGGTCTGCTAATGGTTTTTGGCTACATTACAAACGACTTGAAAAAGGCGCATTTAAGTGGCCAGGG
ATTGAGGATAATAAATTATCGATTCGCATCTCTGCTCGACAGTTGAATTGGCTGCTTGAAGGTCTGCCGATTGATCTGGA
AGGTGCCCATCCTGAATTAATTTATCGCTATCATGGCTGTTAA

Protein sequence :
MFTSSPQVSITLICGPTDMRKAIDGLCDVVAYDLEQDPCSEHLFVFCGRTRNKLKILQWSANGFWLHYKRLEKGAFKWPG
IEDNKLSIRISARQLNWLLEGLPIDLEGAHPELIYRYHGC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-12 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-12 44
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-10 44
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-10 44
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-10 43
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-10 43
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-12 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-09 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-09 41
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-11 41
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-10 41
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-10 41
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-10 41
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-10 41
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-10 41
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-10 41
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-10 41
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-10 41
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-10 41
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-10 41
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-10 41
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-11 41
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 9e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Marme_0627 YP_004311756.1 IS66 Orf2 family protein VFG1737 Protein 2e-12 43
Marme_0627 YP_004311756.1 IS66 Orf2 family protein VFG0792 Protein 1e-10 41
Marme_0627 YP_004311756.1 IS66 Orf2 family protein VFG1698 Protein 1e-10 41
Marme_0627 YP_004311756.1 IS66 Orf2 family protein VFG1709 Protein 1e-10 41
Marme_0627 YP_004311756.1 IS66 Orf2 family protein VFG1052 Protein 1e-10 41