Gene Information

Name : Marme_0141 (Marme_0141)
Accession : YP_004311281.1
Strain : Marinomonas mediterranea MMB-1
Genome accession: NC_015276
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 154389 - 154721 bp
Length : 333 bp
Strand : +
Note : PFAM: Small multidrug resistance protein; KEGG: maq:Maqu_1061 small multidrug resistance protein

DNA sequence : 
ATGAAAACGTGGTTGTTTCTTATTATTGCCATTGGTGCTGAAGTGATGGCGACGACTGCTTTAAAGGCCAGTGATGGCTT
TAGCCGCTTGGTGCCGAGTGTGATTGTCGTGATTGGTTATTCTGTTGCATTTTATTTTTTATCGGTGGTGTTGAAATCGA
TGTCCGTAGGCATTGCTTATGCTATCTGGGCGGGGCTTGGCATTGTACTCACGGCTCTTTTAGGTTGGGTTTTATTTGAG
CAGAAGCTTGATGCACCAGCGTTTATTGGCATAGCGATGATTCTCGGCGGAGTAGTGGTGATCAACTTATTTTCTAAAAC
CGGTGGACACTGA

Protein sequence : 
MKTWLFLIIAIGAEVMATTALKASDGFSRLVPSVIVVIGYSVAFYFLSVVLKSMSVGIAYAIWAGLGIVLTALLGWVLFE
QKLDAPAFIGIAMILGGVVVINLFSKTGGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-26 58
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-26 58
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-26 58
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-26 58
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-26 58
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-26 58
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-26 58
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-26 58
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-26 58
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-26 58
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 58
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-26 58
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 58
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-26 58
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 58
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-26 58
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-26 58
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-26 58
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-26 58
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-26 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0324 Protein 6e-29 62
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0322 Protein 4e-31 60
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0323 Protein 6e-27 58
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0377 Protein 1e-21 57
Marme_0141 YP_004311281.1 small multidrug resistance protein CP004022.1.gene1549. Protein 7e-23 56
Marme_0141 YP_004311281.1 small multidrug resistance protein CP001138.1.gene1489. Protein 2e-25 55
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0002 Protein 2e-25 54
Marme_0141 YP_004311281.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 2e-25 54
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0192 Protein 2e-18 51
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0150 Protein 1e-19 50
Marme_0141 YP_004311281.1 small multidrug resistance protein NC_002695.1.913273.p Protein 2e-19 50
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0139 Protein 2e-16 46
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0140 Protein 2e-13 42
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0329 Protein 2e-15 42
Marme_0141 YP_004311281.1 small multidrug resistance protein BAC0327 Protein 3e-14 42