Gene Information

Name : Clole_1229 (Clole_1229)
Accession : YP_004308155.1
Strain : Clostridium lentocellum DSM 5427
Genome accession: NC_015275
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1411418 - 1411996 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein; KEGG: aoe:Clos_0702 stress protein

DNA sequence : 
ATGGCAATTAATTTAGTAAAAGGCCAAAAAATTGATTTAACAAAAGGAAACCCAGCTTTAAAAAAGGTTATTATTGGACT
TGGTTGGGATACTAATAAGTATTCAGGAGGTTTTGACTTTGATCTAGATGCCTCTGTATTCTTGGTAGGAAGTAATGGTA
GAACGAATCATGATGAAGACTTTATCTTTTACAATAATTTAAAGAGTAGAAATGAAGCTGTTATTCATACAGGAGATAAC
CGTACAGGCGAAGGGGATGGCGATGATGAGCAAATCCTTCTTGAATTTGCAAAAATGCCTGCTGATGTGGAAAAAATGGC
TGTGACCGTAACTATTCATGAAGCTATAGAAAGAGGTCAAAACTTTGGACAAGTATCTAATGCTTATGTACGTGTTATTA
ATAAAGATACAGGAGAAGATGTATTACGTTATGATTTAGGGGAAGACTTCTCTATAGAAACGGCTATTGTAGTATGTGAA
ATTTATAGGAATGGAGCTGACTGGAAATTCAGTGCTGTAGGTAGTGGTTTCCAAGGTGGTCTTGCTGCACTTTGCAAAAA
CTATGGACTTGATGTATAA

Protein sequence : 
MAINLVKGQKIDLTKGNPALKKVIIGLGWDTNKYSGGFDFDLDASVFLVGSNGRTNHDEDFIFYNNLKSRNEAVIHTGDN
RTGEGDGDDEQILLEFAKMPADVEKMAVTVTIHEAIERGQNFGQVSNAYVRVINKDTGEDVLRYDLGEDFSIETAIVVCE
IYRNGADWKFSAVGSGFQGGLAALCKNYGLDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-46 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-46 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-46 53
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-51 53
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-49 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-45 50
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-23 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clole_1229 YP_004308155.1 stress protein BAC0390 Protein 4e-50 56
Clole_1229 YP_004308155.1 stress protein BAC0389 Protein 2e-49 53
Clole_1229 YP_004308155.1 stress protein BAC0392 Protein 1e-22 41