Gene Information

Name : SL003B_2913 (SL003B_2913)
Accession : YP_004304640.1
Strain : Polymorphum gilvum SL003B-26A1
Genome accession: NC_015259
Putative virulence/resistance : Virulence
Product : response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3143686 - 3144360 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence : 
ATGCGCCTGCTTGTTGTCGAGGACGACGCCGATCTCAACCGCCAGCTAACCGAAGCCCTGACCGAGGCCGGCTATGTCGT
CGACCGCGCCTTCGACGGCGAGGAGGGTCATTTCCTCGGCGACACGGAGCCCTATGACGCGGTCGTGCTTGACCTCGGCC
TGCCCAAGCTCGACGGTCTGTCTGTGCTGGAGCGCTGGCGCCGAGACGGGCGCAAGATGCCGGTGCTGATCCTGACCGCG
CGCGACCGCTGGTCGGACAAGGTCGCCGGCATCGATGCGGGCGCGGACGACTACGTCGCCAAGCCGTTCCACATGGAGGA
GGTGCTGGCGCGCGTGCGCGCGCTGGTGCGCCGGGCGGCGGGGCACGCCTCCAACGAGATCGAATGCGGCCCCGTGCGCC
TCGACCTGCGCGCCGGACGGGTGACCGTCGACGGCCATCCCATCAAGCTGACCTCGCACGAGTACCGGCTGCTCGCCTAC
CTGATGCACCACAAGGGCAAGGTGATCTCGCGCACCGAACTGACCGAGCATCTCTACGACCAGGATTTCGACCGGGATTC
GAACACGGTGGAGGTGTTCGTCGGGCGGCTGCGCAAGAAGCTCGGCGGCGAGCCGATCGAGACCATCCGCGGCCTCGGCT
ACCGCATGGGGGACCCCGTTGAGGACCGAGGCTGA

Protein sequence : 
MRLLVVEDDADLNRQLTEALTEAGYVVDRAFDGEEGHFLGDTEPYDAVVLDLGLPKLDGLSVLERWRRDGRKMPVLILTA
RDRWSDKVAGIDAGADDYVAKPFHMEEVLARVRALVRRAAGHASNEIECGPVRLDLRAGRVTVDGHPIKLTSHEYRLLAY
LMHHKGKVISRTELTEHLYDQDFDRDSNTVEVFVGRLRKKLGGEPIETIRGLGYRMGDPVEDRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 9e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain NC_002516.2.879194.p Protein 2e-41 49
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain CP000647.1.gene1136. Protein 1e-37 48
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0530 Protein 1e-37 48
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain CP001918.1.gene2526. Protein 1e-35 47
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain CP000034.1.gene2022. Protein 1e-36 46
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain NC_002695.1.913289.p Protein 4e-36 46
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain CP001138.1.gene1939. Protein 9e-37 46
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain CP004022.1.gene1005. Protein 6e-39 45
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0487 Protein 2e-31 45
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain BAC0197 Protein 4e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain VFG0475 Protein 8e-37 46
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain VFG1390 Protein 2e-24 43
SL003B_2913 YP_004304640.1 response regulators consisting of a chemotaxis protein CheY domain and a winged-helix DNA-binding domain VFG1389 Protein 2e-25 42