Name : NAL212_0099 (NAL212_0099) Accession : YP_004293224.1 Strain : Genome accession: NC_015221 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic component Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 2754 - 3035 bp Length : 282 bp Strand : + Note : KEGG: net:Neut_2569 mercuric transport protein periplasmic component; TIGRFAM: Mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGAAAAAACTGTTTGCCTCCCTCGCCCTCGCCCTCGCTGCCGTTGTTGTCCCCGTGTGGGCCGCCACCCAGACCGTCAC GCTGTCCGTACCGGGCATGACCTGCGCCGCCTGCCCGATCACCGTCAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCA AAGTTGACGTGACCTTCGAGACACGCGAAGCGGTTGTCACCTTCGATGATGCCAAGACCAGCGTGCAGAAGCTGGCCAAG GCAATCGGAGACGCGGGCTATCCGTCCAGCGTCAAGCAGTGA Protein sequence : MKKLFASLALALAAVVVPVWAATQTVTLSVPGMTCAACPITVKKAISKVEGVSKVDVTFETREAVVTFDDAKTSVQKLAK AIGDAGYPSSVKQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 5e-24 | 88 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 5e-24 | 88 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 5e-24 | 88 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 5e-24 | 88 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 5e-24 | 88 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 7e-24 | 88 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 1e-22 | 81 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 8e-23 | 81 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 3e-22 | 77 |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 5e-21 | 75 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
NAL212_0099 | YP_004293224.1 | mercuric transport protein periplasmic component | BAC0679 | Protein | 2e-25 | 96 |
NAL212_0099 | YP_004293224.1 | mercuric transport protein periplasmic component | BAC0678 | Protein | 2e-25 | 93 |
NAL212_0099 | YP_004293224.1 | mercuric transport protein periplasmic component | BAC0231 | Protein | 7e-25 | 92 |
NAL212_0099 | YP_004293224.1 | mercuric transport protein periplasmic component | BAC0675 | Protein | 1e-20 | 72 |
NAL212_0099 | YP_004293224.1 | mercuric transport protein periplasmic component | BAC0674 | Protein | 1e-16 | 61 |