Gene Information

Name : NAL212_0099 (NAL212_0099)
Accession : YP_004293224.1
Strain :
Genome accession: NC_015221
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 2754 - 3035 bp
Length : 282 bp
Strand : +
Note : KEGG: net:Neut_2569 mercuric transport protein periplasmic component; TIGRFAM: Mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGAAAAAACTGTTTGCCTCCCTCGCCCTCGCCCTCGCTGCCGTTGTTGTCCCCGTGTGGGCCGCCACCCAGACCGTCAC
GCTGTCCGTACCGGGCATGACCTGCGCCGCCTGCCCGATCACCGTCAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCA
AAGTTGACGTGACCTTCGAGACACGCGAAGCGGTTGTCACCTTCGATGATGCCAAGACCAGCGTGCAGAAGCTGGCCAAG
GCAATCGGAGACGCGGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLFASLALALAAVVVPVWAATQTVTLSVPGMTCAACPITVKKAISKVEGVSKVDVTFETREAVVTFDDAKTSVQKLAK
AIGDAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 5e-24 88
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 5e-24 88
merP AFG30122.1 MerP Not tested PAGI-2 Protein 5e-24 88
merP AGK07023.1 MerP Not tested SGI1 Protein 5e-24 88
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 7e-24 88
merP AGK07081.1 MerP Not tested SGI1 Protein 5e-24 88
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 8e-23 81
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-22 81
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 3e-22 77
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 5e-21 75

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NAL212_0099 YP_004293224.1 mercuric transport protein periplasmic component BAC0679 Protein 2e-25 96
NAL212_0099 YP_004293224.1 mercuric transport protein periplasmic component BAC0678 Protein 2e-25 93
NAL212_0099 YP_004293224.1 mercuric transport protein periplasmic component BAC0231 Protein 7e-25 92
NAL212_0099 YP_004293224.1 mercuric transport protein periplasmic component BAC0675 Protein 1e-20 72
NAL212_0099 YP_004293224.1 mercuric transport protein periplasmic component BAC0674 Protein 1e-16 61