Gene Information

Name : NAL212_0097 (NAL212_0097)
Accession : YP_004293222.1
Strain :
Genome accession: NC_015221
Putative virulence/resistance : Resistance
Product : transcriptional regulator, MerR family
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1867 - 2301 bp
Length : 435 bp
Strand : -
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; KEGG: mms:mma_1754 putative transcriptional regulator MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
ATGGGAAACAATTTGGAGAATCTGACCATCGGCGTTTTCGCCAAGGTAGCCGGGGTCAACGTGGAGACCATCCGGTTTTA
TCAGCGCAAGGGCTTGTTGTCGGAGCCGGACAAGCCCTATGGCAGCATCCGCCGCTATGGCGAGGCGGATGTAACGCGGG
TGCGGTTCGTGAAATCAGCCCAGCGGCTGGGCTTCAGTTTGGATGAAATCGCCGAGCTGCTGCGGCTGGAGGATGGCACC
CATTGCGAGGAAGCCAGTAGCCTAGCCGAGCACAAGCTCAAGGACGTGCGCGAGAAAATGGCTGACTTGGCGCGCATGGA
GGCCGTGCTGTCTGATCTGGTGTGCGCCTGCCATGCGCGGAAGGGGAATGTTTCCTGCCCGCTGATTGCGTCTCTGCAAG
GGAAGAAAGAACCTCATAGTGCCGCCGTGACGTAG

Protein sequence :
MGNNLENLTIGVFAKVAGVNVETIRFYQRKGLLSEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGT
HCEEASSLAEHKLKDVREKMADLARMEAVLSDLVCACHARKGNVSCPLIASLQGKKEPHSAAVT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-57 95
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-57 95
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-57 95
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-57 95
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-57 95
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-56 95
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-56 94
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-56 94
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-48 77
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-45 72
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-27 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NAL212_0097 YP_004293222.1 transcriptional regulator, MerR family BAC0687 Protein 7e-58 97
NAL212_0097 YP_004293222.1 transcriptional regulator, MerR family BAC0232 Protein 7e-58 97
NAL212_0097 YP_004293222.1 transcriptional regulator, MerR family BAC0684 Protein 1e-57 95
NAL212_0097 YP_004293222.1 transcriptional regulator, MerR family BAC0683 Protein 2e-57 94
NAL212_0097 YP_004293222.1 transcriptional regulator, MerR family BAC0688 Protein 8e-61 93
NAL212_0097 YP_004293222.1 transcriptional regulator, MerR family BAC0689 Protein 1e-54 92
NAL212_0097 YP_004293222.1 transcriptional regulator, MerR family BAC0686 Protein 5e-58 89