Gene Information

Name : vicR (SGGBAA2069_c15800)
Accession : YP_004288496.1
Strain : Streptococcus gallolyticus ATCC BAA-2069
Genome accession: NC_015215
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1638029 - 1638739 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence : 
ATGAAAAAAATTCTTATCGTTGATGATGAAAAACCAATTTCGGATATTATTAAATTTAATTTAACTAAAGAAGGTTATGA
AACCGTAACGGCTTTTGATGGTCGTGAGGCTATTACAAAGTTTGAGGAAGAAGATCCAGATTTGATTATCTTGGATTTGA
TGTTGCCAGAATTGGACGGACTTGAAGTGGCTAAAGAAGTTCGCAAGACAAGTCATATTCCAATCATTATGTTGTCTGCT
AAGGATAGCGAGTTTGATAAAGTTATCGGACTTGAAATCGGTGCAGATGACTATGTAACCAAACCATTTTCAAATCGTGA
ATTGTTGGCGCGTGTTAAAGCGCACCTTCGTCGTACAGAAAATATTGAAACAGCAGTTGCTGAAGAAAATGCTTCTGCTT
CAAATTCAGAAATCACAATTGGCGACTTGAAAATCTTACCAGACGCCTTTGTGGCACAAAAACGTGGTGAAGATATCGAA
TTAACACACCGTGAGTTTGAATTGCTACATCATTTGGCAACACATATGGGACAAGTCATGACCCGTGAATATCTTTTGGA
AACCGTTTGGGGCTATGATTATTTTGGTGATGTGCGTACGGTTGACGTAACCATTCGTCGTTTACGTGAAAAAATCGAAG
ACACACCAAGCCGTCCAGAATATATTTTGACACGTCGTGGTGTTGGGTACTACATGAAGTCATATGAATGA

Protein sequence : 
MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAITKFEEEDPDLIILDLMLPELDGLEVAKEVRKTSHIPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTENIETAVAEENASASNSEITIGDLKILPDAFVAQKRGEDIE
LTHREFELLHHLATHMGQVMTREYLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMKSYE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-29 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_004288496.1 two-component response regulator NC_012469.1.7685629. Protein 1e-75 78
vicR YP_004288496.1 two-component response regulator HE999704.1.gene2815. Protein 8e-44 54
vicR YP_004288496.1 two-component response regulator NC_002952.2859905.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_002951.3237708.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_007622.3794472.p0 Protein 5e-45 53
vicR YP_004288496.1 two-component response regulator NC_002745.1124361.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_009782.5559369.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_007793.3914279.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_002758.1121668.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_003923.1003749.p0 Protein 5e-45 53
vicR YP_004288496.1 two-component response regulator NC_009641.5332272.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_013450.8614421.p0 Protein 6e-45 53
vicR YP_004288496.1 two-component response regulator NC_012469.1.7686381. Protein 4e-36 50
vicR YP_004288496.1 two-component response regulator AE016830.1.gene1681. Protein 4e-39 47
vicR YP_004288496.1 two-component response regulator FJ349556.1.orf0.gene Protein 8e-32 45
vicR YP_004288496.1 two-component response regulator HE999704.1.gene1528. Protein 2e-27 44
vicR YP_004288496.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-31 44
vicR YP_004288496.1 two-component response regulator AE000516.2.gene3505. Protein 1e-29 44
vicR YP_004288496.1 two-component response regulator AM180355.1.gene1830. Protein 2e-29 43
vicR YP_004288496.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-30 42
vicR YP_004288496.1 two-component response regulator AF162694.1.orf4.gene Protein 3e-27 42
vicR YP_004288496.1 two-component response regulator DQ212986.1.gene4.p01 Protein 2e-28 42
vicR YP_004288496.1 two-component response regulator CP001918.1.gene5135. Protein 6e-23 42
vicR YP_004288496.1 two-component response regulator AE015929.1.gene1106. Protein 2e-25 41
vicR YP_004288496.1 two-component response regulator NC_005054.2598277.p0 Protein 1e-31 41
vicR YP_004288496.1 two-component response regulator NC_014475.1.orf0.gen Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_004288496.1 two-component response regulator VFG1389 Protein 3e-25 44
vicR YP_004288496.1 two-component response regulator VFG1563 Protein 4e-29 42
vicR YP_004288496.1 two-component response regulator VFG1702 Protein 4e-29 41