Gene Information

Name : ACMV_26130 (ACMV_26130)
Accession : YP_004284842.1
Strain : Acidiphilium multivorum AIU301
Genome accession: NC_015186
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2875701 - 2876171 bp
Length : 471 bp
Strand : -
Note : -

DNA sequence :
ATGGCCGCGCGTGAGGCGGGCGTCGGCGTCGAGACGATCCGCTTCTATGAGCGGCAGCATCTGGTCCGACAGCCGCCGAA
GCCGGACGGTTCGGGCGCGCGGCGCTATTCCGCCGATACGGTCGGGCGCATCCGGTTCATCAAGGAAGCCCAGGAGCTCG
GCTTCTCGCTGCGCGAGATCCACGAACTGCTGGCCCTGCGGGCCGATCCCGCTGCCGACTGCTCGGAAGTCCGGGAGCAG
GCCACCACGAAACTTGCTGACGTGCGGCGGAAGATCCAGCGGCTCCAGGATATCGGCGCCGCGCTGGAGCGGCTGATTGC
GGCCTGCCCTGGCCAAGGCGCCTTACAGGCGTGCTCGATCATGGACGCCCTGACGCCTCGCTCCGGCGGGTGCGCCGAGA
ATGGGAGGCGCCAGCACACCAACCCGAGAAAATCGTCCTGCACAAAGCATAAAAAAGAGAACACGCGATGA

Protein sequence :
MAAREAGVGVETIRFYERQHLVRQPPKPDGSGARRYSADTVGRIRFIKEAQELGFSLREIHELLALRADPAADCSEVREQ
ATTKLADVRRKIQRLQDIGAALERLIAACPGQGALQACSIMDALTPRSGGCAENGRRQHTNPRKSSCTKHKKENTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-22 46
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-21 46
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-21 46
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-21 45
merR ACK44535.1 MerR Not tested SGI1 Protein 4e-22 45
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 4e-22 45
merR AFG30124.1 MerR Not tested PAGI-2 Protein 4e-22 45
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 6e-22 45
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-21 45
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-23 44
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ACMV_26130 YP_004284842.1 MerR family transcriptional regulator BAC0684 Protein 2e-22 48
ACMV_26130 YP_004284842.1 MerR family transcriptional regulator BAC0232 Protein 2e-21 46
ACMV_26130 YP_004284842.1 MerR family transcriptional regulator BAC0686 Protein 4e-22 46
ACMV_26130 YP_004284842.1 MerR family transcriptional regulator BAC0687 Protein 2e-21 46
ACMV_26130 YP_004284842.1 MerR family transcriptional regulator BAC0683 Protein 8e-22 46
ACMV_26130 YP_004284842.1 MerR family transcriptional regulator BAC0689 Protein 1e-21 46
ACMV_26130 YP_004284842.1 MerR family transcriptional regulator BAC0688 Protein 2e-22 45