Gene Information

Name : ACMV_20350 (ACMV_20350)
Accession : YP_004284264.1
Strain : Acidiphilium multivorum AIU301
Genome accession: NC_015186
Putative virulence/resistance : Unknown
Product : putative transposase for insertion sequence element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2260227 - 2260574 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATCGCACCCGGCGCGGGTGTCCGGGTCTATCTTGCCTGCGGCCGGACGGACATGAGGAAGGGGCTGGACGGGCTGGC
GATGCTGGTCCAGCAGGTCTTTGGCGGGAACCCGTTTGATGGTGCGGTCTACGCATTCCGCGGCCGGCGTGCCGGACAGA
TCAAGCTGCTCTGGCATGACGGGGTGGGGTTGTGCCTGCTGACCAGGCGGCTGGAACGAGGCGCGTTTGCCTGGCCGCAA
AGCGGGACGGCGCTGATGTCGCTGAGCCCGGCGCAACTTGCCACGCTGCTCGAGGGCTGCGAATGGCGGGCTCCGGTGCA
AAGCCTGCGGCCGGTGCTGGCGGGATAG

Protein sequence :
MIAPGAGVRVYLACGRTDMRKGLDGLAMLVQQVFGGNPFDGAVYAFRGRRAGQIKLLWHDGVGLCLLTRRLERGAFAWPQ
SGTALMSLSPAQLATLLEGCEWRAPVQSLRPVLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 5e-18 54
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 9e-26 52
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 9e-26 52
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-24 51
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-24 51
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-25 51
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-24 50
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-24 50
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-22 50
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-24 50
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-24 50
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-23 50
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-23 50
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-24 50
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-24 50
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-24 50
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-24 50
unnamed AAL08461.1 unknown Not tested SRL Protein 9e-24 49
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-23 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-23 49
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-23 48
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-21 47
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-21 47
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-22 46
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-22 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ACMV_20350 YP_004284264.1 putative transposase for insertion sequence element VFG1517 Protein 2e-18 54
ACMV_20350 YP_004284264.1 putative transposase for insertion sequence element VFG1698 Protein 4e-25 51
ACMV_20350 YP_004284264.1 putative transposase for insertion sequence element VFG1665 Protein 7e-26 51
ACMV_20350 YP_004284264.1 putative transposase for insertion sequence element VFG1709 Protein 2e-24 50
ACMV_20350 YP_004284264.1 putative transposase for insertion sequence element VFG0792 Protein 2e-24 50
ACMV_20350 YP_004284264.1 putative transposase for insertion sequence element VFG1052 Protein 4e-24 49
ACMV_20350 YP_004284264.1 putative transposase for insertion sequence element VFG1737 Protein 7e-24 48