Gene Information

Name : Acav_4570 (Acav_4570)
Accession : YP_004237019.1
Strain : Acidovorax avenae ATCC 19860
Genome accession: NC_015138
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5222965 - 5223639 bp
Length : 675 bp
Strand : -
Note : KEGG: dia:Dtpsy_3349 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver d

DNA sequence : 
ATGCGCATCCTCATTGCCGAAGACGATCAGGTTCTGGCGGATGGCCTGCTGCGCACGCTGCGGGGTTCCGGCGCCGCGGT
GGACCATGTGGCGAGCGGCAGCGATGCCGACACCGTGCTCGCGACGACGCAGGAATTCGACCTGCTGATCCTCGACCTCG
GCCTGCCGCGCATGCATGGGCTGGACGTGCTCAAGCGGCTGCGTGGCCGCGGTTCGGCGCTGCCGGTGCTGATCCTCACG
GCGGCCGACAGCGTCGACGAGCGCGTGAAAGGCCTGGACTACGGCGCCGACGACTACATGGCCAAGCCCTTCTCGCTGCA
GGAACTGGAGGCGCGCGTGCGCGCCCTCACGCGCCGCGGCATGGGCGCCACCAGCAGCACCATCCGGCACGGCCCGCTCG
TCTATGACCAGGCAGGGCGCATGGCCACCATCGATGGCAAGCTGGTCGAGCTGTCCGCCCGCGAACTGGGCCTGCTGGAA
GTGCTGCTGCAGCGTGCCGGGCGGCTGGTGAGCAAGGAGCAACTGGTGGAGCGGCTCTGCGAGTGGGGCGAGGAAGTGAG
CAACAACGCCATCGAGGTGTACATCCACCGCCTGCGCAAGAAGATCGAGCGCGGGCCGATCCGCATCGCCACGGTGCGGG
GGCTGGGCTACTGCCTGGAGAAGGTCGCCGCCTAG

Protein sequence : 
MRILIAEDDQVLADGLLRTLRGSGAAVDHVASGSDADTVLATTQEFDLLILDLGLPRMHGLDVLKRLRGRGSALPVLILT
AADSVDERVKGLDYGADDYMAKPFSLQELEARVRALTRRGMGATSSTIRHGPLVYDQAGRMATIDGKLVELSARELGLLE
VLLQRAGRLVSKEQLVERLCEWGEEVSNNAIEVYIHRLRKKIERGPIRIATVRGLGYCLEKVAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-38 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-36 46
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-34 44
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-32 44
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-31 42
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator BAC0638 Protein 8e-27 42
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator VFG0473 Protein 4e-38 44
Acav_4570 YP_004237019.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-33 42