Gene Information

Name : Acav_1753 (Acav_1753)
Accession : YP_004234238.1
Strain : Acidovorax avenae ATCC 19860
Genome accession: NC_015138
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1952116 - 1952580 bp
Length : 465 bp
Strand : +
Note : KEGG: ajs:Ajs_2593 MerR family transcriptional regulator; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
GTGTCCGCCGCAAGTCCCCACCACCGTATCGGCGATGCCGCCCGCCTCTCGGGCGTGCCCACCGCCAACATCCGCTACTA
CGAGAAGGAAGGGCTGCTGCCCGCCCAGGCCCGCGCCGACAACCGCTACCGCCTCTACAGTGACGAAGAAATCCACCGCC
TGCGGTTCATCCGCCTGTGCCGCGCCATGGACATGTCGCTGGACGAAGTGCGCACGCTGCTCTCGCTCGGCCGGGGCACG
GACACCGCCGCAGACCATGCGGCCTGCGCCACGGTGGACGATCACCTGCTGCACGTGCGCACCCGCCTGCGGGAGCTGCA
GGCGCTGGAGGCCCAGTTGCTGTCGCTGCGCGGGCGCTGCGACGGTACCGACGGCAGCCGCTGCCACGTGATCGAGGCCC
TCCATGACCGTGCCGATGCCGACCCCCTGCCGCTGCCCGATCCGCCGGCGCGCCGGCATGTGTGA

Protein sequence :
MSAASPHHRIGDAARLSGVPTANIRYYEKEGLLPAQARADNRYRLYSDEEIHRLRFIRLCRAMDMSLDEVRTLLSLGRGT
DTAADHAACATVDDHLLHVRTRLRELQALEAQLLSLRGRCDGTDGSRCHVIEALHDRADADPLPLPDPPARRHV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 2e-15 44
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-14 44
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-14 44
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 1e-14 44
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-14 44
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-14 44
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 9e-15 44
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 9e-15 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acav_1753 YP_004234238.1 MerR family transcriptional regulator BAC0058 Protein 2e-18 43