Gene Information

Name : BC1001_5304 (BC1001_5304)
Accession : YP_004231745.1
Strain :
Genome accession: NC_015137
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1924308 - 1924994 bp
Length : 687 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: bgf:BC1003_4117 winged helix family two component transcriptional regulator; SMART: response regulator receiver; transcr

DNA sequence :
ATGAAATTGCTGATTGTTGAAGACGAGCACAAGGTGGTGGACTACCTGCGCTCCGGTTTGACAGAGCAGGGTTGGGTCGT
GGATGTCGCGCTCGACGGCGAGGAAGGCATGCATCTGGCCACCGAGTTCGATTACGACGTCATCGTGCTCGACGTCATGC
TGCCCAAGCGCGACGGCTTCAGCGTGCTGAAGGCTCTGCGCATGCGCAAGTCGACGCCGGTCATCATGCTCACCGCGCGC
GATCATGTGAACGACCGCGTGCGCGGCCTGCGCGAAGGCGCGGACGACTACCTCACCAAACCTTTCTCGTTCCTCGAACT
GGTCGAACGCCTGCACGCGCTCGCGCGCCGCACGCGGTCGCAGGAATCCACGCTGATTTCGGTCGGCGATCTGTTTGTCG
ATCTGATCGGCCGGCGCGCGACACGTGACGGCGTGCGGCTCGATTTGACCGCGAAAGAATTCCAGTTGCTGAGCGTTCTG
GCCCGCAGGCAAGGCGACATTCTGTCGAAGACGGCCATCACCGAGCTGGTGTGGGACGTCAACTTCGACAGTCATACGAA
CGTGGTGGAGACGGCCATCAAACGATTGCGCGCGAAGCTGGACGGCCCGTTTCCGTCGAAGCTGCTGCATACCGTGCGCG
GCATGGGTTACGTGCTCGAAGTGCGTGAAGAGGCGGAGCCGTCATGA

Protein sequence :
MKLLIVEDEHKVVDYLRSGLTEQGWVVDVALDGEEGMHLATEFDYDVIVLDVMLPKRDGFSVLKALRMRKSTPVIMLTAR
DHVNDRVRGLREGADDYLTKPFSFLELVERLHALARRTRSQESTLISVGDLFVDLIGRRATRDGVRLDLTAKEFQLLSVL
ARRQGDILSKTAITELVWDVNFDSHTNVVETAIKRLRAKLDGPFPSKLLHTVRGMGYVLEVREEAEPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-49 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-48 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 1e-58 57
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-52 55
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 2e-58 55
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 1e-44 51
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 6e-53 51
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 7e-53 50
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 1e-46 47
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 1e-31 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-32 41
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-49 52
BC1001_5304 YP_004231745.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 5e-38 50