Gene Information

Name : BC1001_0033 (BC1001_0033)
Accession : YP_004226559.1
Strain :
Genome accession: NC_015136
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 34060 - 34491 bp
Length : 432 bp
Strand : +
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: bgf:BC1003_0046 MerR family transcriptional regulator; SMART: regulatory protein MerR

DNA sequence : 
ATGAAAATCGGCGAATTGGCGAAAATCGCCCATTGCACGACCGAAACCATCCGCTTCTACGAGAAAGAAGGGCTGTTGCC
CGAAGCGGAGCGCACCGAGGCCAATTACCGCAGCTATTCGGCGAAGCACGTCGAGCGGTTGCGCTTCATCCGCAATTGCC
GCGCGCTCGACATGACGCACGACGAAATCCGCGCGCTGCTCAGTCTGACCGACGCGCCGGCCAACGGCTGCGGCGGCATC
AACGACCTGATCGACGAGCACATTGCGCACGTCGATACGCGTATCGACGAATTGCAGCAGTTGAAGGCGCAACTGCGTGC
GCTGCGCGAGCAATGTCACGGCGAACAGGCGGTCGAAGACTGCGGCATCGTGCAAGGCCTCAGCGAAATGGACGTGAGCG
CACCGCGCGCGCGGCACACGCATCTCGGTTAA

Protein sequence : 
MKIGELAKIAHCTTETIRFYEKEGLLPEAERTEANYRSYSAKHVERLRFIRNCRALDMTHDEIRALLSLTDAPANGCGGI
NDLIDEHIAHVDTRIDELQQLKAQLRALREQCHGEQAVEDCGIVQGLSEMDVSAPRARHTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 7e-29 53
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-26 49
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 7e-27 49
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-26 49
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 6e-27 49
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-26 49
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 4e-27 49
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 4e-27 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1001_0033 YP_004226559.1 MerR family transcriptional regulator BAC0301 Protein 4e-33 61
BC1001_0033 YP_004226559.1 MerR family transcriptional regulator BAC0058 Protein 2e-34 57