Gene Information

Name : mtrA (MTES_0528)
Accession : YP_004223372.1
Strain : Microbacterium testaceum StLB037
Genome accession: NC_015125
Putative virulence/resistance : Virulence
Product : response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 552422 - 553102 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGACTTCACGGATCCTGGTTGTCGACGACGACACCGCACTGGCCGAGATGATCGGCATCGTGCTGCGCACCGAAGGATT
CGACACGGTCTTCTGCGCCGACGGCGCCCAGGCCGTCGACGCCTGGCGTACCGAGCGGCCCGATCTGATCCTGCTCGACC
TCATGCTGCCCGGCGTCGACGGCATCGAGATCTGCACGCGCGTGCGCGCCGAGTCCGGCGTGCCGATCATCATGCTCACG
GCCCGCACCGACACCGCCGACGTGGTGAAGGGGCTCGAGTCCGGTGCCGACGACTACATCATGAAGCCGTTCAACCCGAA
GGAGCTCGTCGCCCGCATCCGCACCCGCCTGCGCCCGGTGCAGGTACCGGTCGACGAGACGCTGCGCATCGGCGACCTCG
TGGTCGACGTGGCCGCACACGAGGTGCGGCGGGGCGACAACCCGATCGCGCTCACCCCGCTCGAGTTCGAGCTCCTCGTC
GCCCTCGCCGAGAAGCCGCAGCAGGTGTTCTCCCGCGAGATGTTGCTCGAGCAGGTCTGGGGCTATCACTACAAGGCGGA
CACGCGCCTGGTGAACGTGCACGTCCAGCGACTCCGGGCGAAGATCGAGGCCGACCCCGACAACCCCCGCATCGTCACCA
CCGTCCGCGGTGTGGGCTATCGCGCCGGCGCGGTGGCTTGA

Protein sequence :
MTSRILVVDDDTALAEMIGIVLRTEGFDTVFCADGAQAVDAWRTERPDLILLDLMLPGVDGIEICTRVRAESGVPIIMLT
ARTDTADVVKGLESGADDYIMKPFNPKELVARIRTRLRPVQVPVDETLRIGDLVVDVAAHEVRRGDNPIALTPLEFELLV
ALAEKPQQVFSREMLLEQVWGYHYKADTRLVNVHVQRLRAKIEADPDNPRIVTTVRGVGYRAGAVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-67 69
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 1e-43 45
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 5e-37 44
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-45 44
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 4e-46 44
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 7e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 5e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 5e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 5e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 5e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 6e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 5e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 5e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 5e-46 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-43 42
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 9e-34 42
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 2e-34 42
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene3671. Protein 6e-37 42
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 3e-38 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000675.2.gene1535. Protein 1e-33 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 3e-41 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 2e-34 41
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene3444. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 7e-35 44
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 8e-40 43
mtrA YP_004223372.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1702 Protein 7e-37 41