Gene Information

Name : MTES_3011 (MTES_3011)
Accession : YP_004225855.1
Strain : Microbacterium testaceum StLB037
Genome accession: NC_015125
Putative virulence/resistance : Virulence
Product : response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3268381 - 3269037 bp
Length : 657 bp
Strand : -
Note : -

DNA sequence :
ATGACCCGCATCCTCATCGCCGAGGACGAAGAACGCATCGCCGCGTTCGTCGCGAAAGGTCTGGAGGCCGCCGGCTACCA
GACCGTGACCGTCGACGACGGCGCCGACGCGCTCGACACCGCTCTCTCCGGCGAGGTCGACCTCGTGCTGCTCGACGTCG
GGCTGCCCACGATCGACGGCTTCGAGGTCCTGCGCACGCTGCGCGGACAGGGTTCCGCGCTGCCCGTGATCATGCTCACC
GCGCGCACGAGCACGCGCGACACCGTGGACGGCCTCGACGCCGGCGCGAACGACTACATGGCGAAGCCCTTCAAGTTCGA
CGAACTGCTGGCGCGCGTCCGATCGCGCCTTCGAGAACCCGTGACGGCGAACACGATCTCGATCTCGCACGGGGATGTCA
CGCTCGACGTCCGCGGCCGTCGAGCGAGCATCGACGGTCGCGAGGTGGACCTGAGCGCGCGGGAGTTCGCCCTCGCCGAG
GAGTTCCTCCGACACGCCGGACAGGTCCTCAGCCGCGAGCAACTGCTCAGCCGGGTGTGGGGCATGGACTTCGATCCCGG
ATCGAACGTCGTCGACGTCTACGTCCGCTACCTCCGCGGCAAGTTCGGGGCGGCGCGCATCGCGACCGTCCGCGGCGCCG
GGTACCGCTGGGAGTAG

Protein sequence :
MTRILIAEDEERIAAFVAKGLEAAGYQTVTVDDGADALDTALSGEVDLVLLDVGLPTIDGFEVLRTLRGQGSALPVIMLT
ARTSTRDTVDGLDAGANDYMAKPFKFDELLARVRSRLREPVTANTISISHGDVTLDVRGRRASIDGREVDLSAREFALAE
EFLRHAGQVLSREQLLSRVWGMDFDPGSNVVDVYVRYLRGKFGAARIATVRGAGYRWE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 2e-31 45
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 1e-36 44
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 1e-32 44
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 3e-35 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 2e-29 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 1e-37 43
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-30 41
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 4e-33 44
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 4e-35 44
MTES_3011 YP_004225855.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 1e-33 43