Gene Information

Name : Rahaq_1379 (Rahaq_1379)
Accession : YP_004212129.1
Strain : Rahnella sp. Y9602
Genome accession: NC_015061
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1503437 - 1504111 bp
Length : 675 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: ddd:Dda3937_00228 DNA-binding heavy metal response regulator; SMART: response regulator receiver

DNA sequence :
ATGCGAATACTGGTGATTGAAGACGATGTCAGTACAGGCGATTACCTGAAAAAAGGGCTGACAGAAGCAGGTTACAGCGT
AGATCTGGCGCGCAACGGTGCCGACGGCCTGTTTCTGGCGCTGGAAGAGGGTTACGACGCGGTGATCCTCGACGTCATGC
TGCCGGGGCTGAACGGCTGGCAGGTGATGGAAGTCCTGCGCAAAAAGAGCGACGTGCCGGTGCTGTTTCTCACCGCCCGC
GATGAAGTACAGGATCGCATTCACGGGCTGGAGCTGGGGGCTGACGACTATCTCATCAAACCGTTCTCCTTCACCGAACT
GGTGTTGCGTATCCGCACCTTGCTGCGCCGCCCGGCCGCCCGTGAGCCGGATGCGTATTCGGTGGCGGATCTGAATCTTG
ATGTGCTGCGCCGCCGCGTGACCCGTCAGGATCAGACCATCGCACTGACCAATAAGGAATTCATGTTGCTGCAGTTGCTG
ATGCGCCGTGAGGGTGAGGTTCTGTCGCGAACCATGATCGCCTCGCAGGTCTGGGATATGAATTTCGACAGCGATACCAA
TGTAGTGGATGTCGCCATTAAGCGTCTGCGTGCCAAGGTTGACCGCAGCTTTGAGGTGAAACTGATCCATACCGTGCGTG
GCATTGGTTACGTGTGCGAAGTGCGACATGAGTGA

Protein sequence :
MRILVIEDDVSTGDYLKKGLTEAGYSVDLARNGADGLFLALEEGYDAVILDVMLPGLNGWQVMEVLRKKSDVPVLFLTAR
DEVQDRIHGLELGADDYLIKPFSFTELVLRIRTLLRRPAAREPDAYSVADLNLDVLRRRVTRQDQTIALTNKEFMLLQLL
MRREGEVLSRTMIASQVWDMNFDSDTNVVDVAIKRLRAKVDRSFEVKLIHTVRGIGYVCEVRHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-56 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-55 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-67 64
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 5e-68 64
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-57 61
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 6e-64 60
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 4e-64 59
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 4e-63 57
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-55 52
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-30 43
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-30 42
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-30 41
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 4e-57 57
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 2e-40 44
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 4e-35 44
Rahaq_1379 YP_004212129.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 5e-35 44