Gene Information

Name : BSn5_13475 (BSn5_13475)
Accession : YP_004206332.1
Strain : Bacillus subtilis BSn5
Genome accession: NC_014976
Putative virulence/resistance : Virulence
Product : two-component response regulator YclK
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2641031 - 2641714 bp
Length : 684 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAATATTAATGATAGAAGATAATGTTAGTGTATGTACGATGACGGAGATGTTCTTTTTTAAAGAAGGTTTTGAAGC
GGAATTCGTTCATGACGGGTTAGAAGGGTACCAGCGTTTTACGGAAGAAAATTGGGATCTGATCATTTTGGATATCATGC
TTCCATCTATGGACGGCGTGACCATCTGCAGAAAAATAAGAGAGACAAGCACGGTGCCGATTATCATGCTGACTGCCAAA
GACACTGAATCAGATCAGGTCATCGGTTTTGAGATGGGGGCGGACGATTATGTCACAAAGCCGTTCAGCCCGCTGACATT
GGTTGCCCGCATCAAAGCCGTCATCAGAAGATATAAGGCGACAGGCAAAGCAGTTATTGATGAAGATATGATCGAAACGG
AATGCTTTACCATTAATAAGAAGACGAGAGAAGTATTATTAAACGGAGAGCCTGTAGAAAATCTCACGCCGAAGGAATTC
GATCTGCTTTATTACCTTGTCCAAAATCAGCGGCAGGTGTTCTCAAGAGAACAGCTGCTTGAGCAGGTATGGGGCTATCA
GTTTTATGGAGATGAGCGGACGGTTGACGTTCATATCAAACGACTGCGGAAAAAGCTTGCCAGCGAGGACAAGCCTTTCC
TGTATACTGTGTGGGGAGTAGGGTATAAATTTGATGAAGATTAA

Protein sequence :
MKILMIEDNVSVCTMTEMFFFKEGFEAEFVHDGLEGYQRFTEENWDLIILDIMLPSMDGVTICRKIRETSTVPIIMLTAK
DTESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYKATGKAVIDEDMIETECFTINKKTREVLLNGEPVENLTPKEF
DLLYYLVQNQRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLASEDKPFLYTVWGVGYKFDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-38 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BSn5_13475 YP_004206332.1 two-component response regulator YclK HE999704.1.gene2815. Protein 7e-44 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_002952.2859905.p0 Protein 3e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_003923.1003749.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_002758.1121668.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_009641.5332272.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_013450.8614421.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_007793.3914279.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_007622.3794472.p0 Protein 3e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_002745.1124361.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_009782.5559369.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_002951.3237708.p0 Protein 4e-41 45
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_012469.1.7685629. Protein 5e-41 44
BSn5_13475 YP_004206332.1 two-component response regulator YclK AE016830.1.gene1681. Protein 1e-41 43
BSn5_13475 YP_004206332.1 two-component response regulator YclK DQ212986.1.gene4.p01 Protein 2e-37 42
BSn5_13475 YP_004206332.1 two-component response regulator YclK AM180355.1.gene1830. Protein 9e-36 42
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_005054.2598277.p0 Protein 3e-38 42
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_014475.1.orf0.gen Protein 3e-38 42
BSn5_13475 YP_004206332.1 two-component response regulator YclK AE015929.1.gene1106. Protein 5e-30 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK HE999704.1.gene1202. Protein 9e-38 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_003923.1003417.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_013450.8614146.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_002951.3238224.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_007793.3914065.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_002758.1121390.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_010079.5776364.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_002952.2859858.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK NC_007622.3794948.p0 Protein 5e-35 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK AF155139.2.orf0.gene Protein 4e-40 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK FJ349556.1.orf0.gene Protein 3e-40 41
BSn5_13475 YP_004206332.1 two-component response regulator YclK AE000516.2.gene3505. Protein 5e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BSn5_13475 YP_004206332.1 two-component response regulator YclK VFG1563 Protein 1e-38 42
BSn5_13475 YP_004206332.1 two-component response regulator YclK VFG1702 Protein 3e-38 42
BSn5_13475 YP_004206332.1 two-component response regulator YclK VFG1389 Protein 2e-31 42