Gene Information

Name : BSn5_13035 (BSn5_13035)
Accession : YP_004206248.1
Strain : Bacillus subtilis BSn5
Genome accession: NC_014976
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2527889 - 2528467 bp
Length : 579 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence : 
ATGGCCATTCAATTATCAAAAGGACAGCGCATTGATTTAACAAAAACAAATCCGGGACTGACAAAAGCGGTGATCGGCTT
AGGCTGGGATACAAACAAGTACTCCGGCGGACACGATTTTGACCTGGATGCTTCGGCCTTTTTAGTTGATGCGCATGATA
ACTGCGTAAATGATCTCGATTTCGTCTTCTATAATAACCTTGAACATCCGAGCGGCGGTGTCATCCATACGGGTGACAAC
CGCACGGGTGAGGGCGACGGAGATGATGAGCAGATTATCGTTGATTTCTCAAAAATCCCTGCTCACATTGAGAAAATCGG
CATCACAGTGACCATTCACGACGCTGAAGCACGCAGCCAAAACTTTGGACAAGTTTCCAATGCATTTGTCCGCGTTGTGG
ATGAAGAAACGCAGAATGAGCTTCTTCGCTTCGATTTGGGAGAAGACTTCTCCATTGAAACAGCTGTTGTCGTTTGTGAG
CTTTACAGACACGGCGGCGAGTGGAAATTCAATGCGATCGGCAGCGGATTTTCCGGCGGGCTGGCTGCATTGTGCCGGAA
TTACGGTTTGCAAGTGTAA

Protein sequence : 
MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCE
LYRHGGEWKFNAIGSGFSGGLAALCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-53 57
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-51 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BSn5_13035 YP_004206248.1 putative stress adaptation protein BAC0390 Protein 2e-51 55
BSn5_13035 YP_004206248.1 putative stress adaptation protein BAC0389 Protein 5e-52 54