Gene Information

Name : TSC_c03880 (TSC_c03880)
Accession : YP_004201574.1
Strain : Thermus scotoductus SA-01
Genome accession: NC_014974
Putative virulence/resistance : Resistance
Product : heavy metal-binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 331379 - 331579 bp
Length : 201 bp
Strand : -
Note : -

DNA sequence :
ATGCTGAAACTCAAGGTAGAAGGCATGACCTGCAACCACTGCGTGATGGCGGTCAAGAAGGCCCTCATGAAGGTGCCCGG
GGTGGAGAAGGCCGAGGTGAGCCTGGAACGGGCCGAGGCCCTGGTGGAGGGCAAGGCGGACCCCGAGGCCTTGATCCGGG
CCGTGGAAGAGGAAGGCTACCGGGCCGCCCTGGCGGGCTAA

Protein sequence :
MLKLKVEGMTCNHCVMAVKKALMKVPGVEKAEVSLERAEALVEGKADPEALIRAVEEEGYRAALAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 3e-11 48
merP AGK07023.1 MerP Not tested SGI1 Protein 4e-09 43
merP AGK07081.1 MerP Not tested SGI1 Protein 4e-09 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 6e-09 43
merP ABQ57373.1 MerP Not tested SGI1 Protein 4e-09 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 4e-09 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 4e-09 43
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 4e-10 41
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 6e-10 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TSC_c03880 YP_004201574.1 heavy metal-binding protein BAC0231 Protein 3e-09 41
TSC_c03880 YP_004201574.1 heavy metal-binding protein BAC0675 Protein 4e-08 41