Gene Information

Name : GM18_1525 (GM18_1525)
Accession : YP_004198268.1
Strain : Geobacter sp. M18
Genome accession: NC_014973
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1839395 - 1840078 bp
Length : 684 bp
Strand : -
Note : KEGG: gbm:Gbem_1865 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing prote

DNA sequence :
ATGCCAGTCATATTGATAATTGAAGATGAAAAAGACCTCGCGGAGCTTATTTCCTTCAACCTGCAGCAGGAGGGTTATAA
AACCGTCATCTCCCATGACGGCGCCGAAGGTTTGGAGGCCGCCAACAGGCTGCAGCCGGACCTCATTCTCCTTGATCTCA
TGCTCCCCGGAATGCTCGGAACAGACGTGTGCAAGTCAATCAGGAAATCCGAAAAGACGAGCCACATACCCGTCATGATG
TTAACGGCAAGAGGAGAGGAGATCGACAAGGTAGTCGGGTTTGAGGTGGGGGCCGACGATTACGTGGTGAAACCCTTCTC
GACCAGGGAACTGATGCTGCGTATCAAGGCCATCCTGCGCCGGAACGCCAATGCTAATTCACCTGCCGAGAGCGCTATCA
TCAATGTCGGATGCATCAGCATCGACACCGAGCGCCACCTCGTGACGGTGGACGGGAAGGAGGTCAGCTTCACCACGACC
GAGTTCAAACTGCTTTACACCCTCGTTATGCGATTTGGCCGGGTCCAAAGCAGGGACGTGTTGCTGAGGGATGTATGGGG
ATACAACTTCGTGGAAGACACCCGTACGGTCGACACCCATGTAACCCGCCTAAGAACCAAGATGGGCGAGGCGGGAGACA
TGATCAAAACCGTCCGCGGCTTCGGCTATAAGCTGGAGGTGTAA

Protein sequence :
MPVILIIEDEKDLAELISFNLQQEGYKTVISHDGAEGLEAANRLQPDLILLDLMLPGMLGTDVCKSIRKSEKTSHIPVMM
LTARGEEIDKVVGFEVGADDYVVKPFSTRELMLRIKAILRRNANANSPAESAIINVGCISIDTERHLVTVDGKEVSFTTT
EFKLLYTLVMRFGRVQSRDVLLRDVWGYNFVEDTRTVDTHVTRLRTKMGEAGDMIKTVRGFGYKLEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-36 45
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-30 45
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-39 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-34 44
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-33 43
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-28 42
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-28 41
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 9e-31 41
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-23 41
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_1525 YP_004198268.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-29 41