Gene Information

Name : GM18_1481 (GM18_1481)
Accession : YP_004198224.1
Strain : Geobacter sp. M18
Genome accession: NC_014973
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1796499 - 1797179 bp
Length : 681 bp
Strand : -
Note : KEGG: gem:GM21_1271 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing prote

DNA sequence :
ATGCAAACCGTACTGATTATCGAGGACGAAACCGACCTCGCGGAACTGATCGCCTATCACCTGGAGAAGGAGGGTTTCCG
CATCCTGGTTGCCGGTGACGGGAGTGCAGGGTTGCAGGAGGCGAGAAAGGCGAAGCCCGATCTGATTCTGCTCGACCTGA
TGCTACCGGGGATGATGGGGACCGAAGTCTGCCGGATCCTGAAAGGGAGCGACCAGACCGCGTCCATCCCGATCATCATG
CTGACCGCGAAAGGGGAGGAGATCGACCGCGTGGTCGGGTTCGAGGTGGGGGCGGACGACTACGTGGTGAAGCCGTTCTC
TACGCGGGAACTGATGCTCCGGGTGCGGGCGGTGCTGAGAAGGAGCAGCGAGCAGACTCCCAAGGCTGCCACCATAACCA
TAGGTGAGCTGGTCATCGACACGGAGCGGCACCTGGTCAGCGTCTGCGGCGAGGAGGTGCTGCTCACCTCGACCGAGTAC
AAGCTCCTGATGAACCTCGCCGAGAGGACCGGGCGCGTGCAGAGCAGGGAGCTTCTGCTGCAAAACGTCTGGGGCTACAG
CTACGTAGGCGACACCCGCACCGTCGACACCCACCTGACCAGGCTGCGCACCAAGCTGGGAAGCGCAGGGGAGCTGATCA
AGACGGTGCGCGGCTTCGGCTACAAGATCGAGGAGCCATGA

Protein sequence :
MQTVLIIEDETDLAELIAYHLEKEGFRILVAGDGSAGLQEARKAKPDLILLDLMLPGMMGTEVCRILKGSDQTASIPIIM
LTAKGEEIDRVVGFEVGADDYVVKPFSTRELMLRVRAVLRRSSEQTPKAATITIGELVIDTERHLVSVCGEEVLLTSTEY
KLLMNLAERTGRVQSRELLLQNVWGYSYVGDTRTVDTHLTRLRTKLGSAGELIKTVRGFGYKIEEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-30 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 5e-32 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-47 46
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-34 45
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-45 45
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 8e-44 45
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-34 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-47 44
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 6e-25 43
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-35 42
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 6e-34 42
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-35 42
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 8e-34 42
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator BAC0039 Protein 6e-34 42
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 4e-31 41
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-29 41
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-29 41
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-29 41
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-31 43
GM18_1481 YP_004198224.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-30 41