Gene Information

Name : Deima_3295 (Deima_3295)
Accession : YP_004172587.1
Strain : Deinococcus maricopensis DSM 21211
Genome accession: NC_014958
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3490557 - 3491222 bp
Length : 666 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: dge:Dgeo_2149 two component transcriptional regulator; PFAM: Signal transduction response regulator, re

DNA sequence : 
GTGAACGCACAAACCATCCTGGTGATCGAGGACGATCACGATATCGCCAACGTCCTGCGCATGGACCTCGCCGACGCGGG
CTTCGAGGTCAAGCACGCCGACGCCGCCATGACCGGCCTGATCAAGGCGCGCGAGGACAACCCGGACCTGATCCTCCTCG
ACCTGGGCCTGCCGGACTTCGACGGCGGCGACGTCGTGCAGCGTCTGCGCAAGAACAGCACGGTGCCCGTCATCGTGCTC
ACCGCGCGCGACACCGTCGACGAGAAGGTCCGCCTGCTCAGCCTCGGCGCGGACGACTACGTCATCAAGCCGTTCCACCC
GGACGAACTGCTCGCGCGCATCAAGGTGCAGCTGCGTCAGCGCGGCAGCGAAACCCTCACGCTCGGCGACCTGCAACTCG
ACCCGCAAAAACGCCTCGTGCTGTTCCAAGGCGAAGAGCTGCGCCTCAGCCCCAAGGAGTTCGACATTCTCGCGCTGCTG
ATGCGCCAGCCGGGCCGCGTGTACTCCCGCCAGGAAATCGGCCAGGAAATCTGGCAGGGCCGCCTGCCCGAAGGCAGCAA
TGTCGTGGACGTACACATGGCGAACCTCCGCGCGAAACTCCGCGACCTCGAAGGGTACGGGCTGCTGCGCACGGTGCGCG
GTGTCGGCTACGCGCTGCGCGGCTGA

Protein sequence : 
MNAQTILVIEDDHDIANVLRMDLADAGFEVKHADAAMTGLIKAREDNPDLILLDLGLPDFDGGDVVQRLRKNSTVPVIVL
TARDTVDEKVRLLSLGADDYVIKPFHPDELLARIKVQLRQRGSETLTLGDLQLDPQKRLVLFQGEELRLSPKEFDILALL
MRQPGRVYSRQEIGQEIWQGRLPEGSNVVDVHMANLRAKLRDLEGYGLLRTVRGVGYALRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 4e-26 41
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 3e-26 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_3295 YP_004172587.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-27 43
Deima_3295 YP_004172587.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-32 43
Deima_3295 YP_004172587.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-27 41
Deima_3295 YP_004172587.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 8e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_3295 YP_004172587.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-25 44
Deima_3295 YP_004172587.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-26 41