Gene Information

Name : Deima_0263 (Deima_0263)
Accession : YP_004169591.1
Strain : Deinococcus maricopensis DSM 21211
Genome accession: NC_014958
Putative virulence/resistance : Resistance
Product : heavy metal transport/detoxification protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 305797 - 306000 bp
Length : 204 bp
Strand : -
Note : COGs: COG2608 Copper chaperone; InterPro IPR006121; KEGG: ddr:Deide_1p01705 hypothetical protein; PFAM: Heavy metal transport/detoxification protein; SPTR: uncharacterized protein; PFAM: Heavy-metal-associated domain

DNA sequence :

ATGAAAACCGAACTGAGCATCAGCGGCATGACCTGCGGCCACTGCCAGGCCGCCGTCACCAAGGCCCTCAAAGACGTCCC
CGGCGTCCAGAACGCCGAAGTGAACCTCCAGGACGGTTCCGCCACCGTCGAGGGCGACGCCAGCGCGCAGGCGCTCATCG
CGGCCGTCGTCGAGGAAGGCTACGGCGCGCAGATCCGCCAGTAA

Protein sequence :

MKTELSISGMTCGHCQAAVTKALKDVPGVQNAEVNLQDGSATVEGDASAQALIAAVVEEGYGAQIRQ

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
unnamed	ABR13399.1	copper-transporting ATPase 2	Not tested	PAGI-5	Protein	6e-08	43

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Deima_0263	YP_004169591.1	heavy metal transport/detoxification protein	BAC0674	Protein	5e-08	41