Gene Information

Name : Deima_2168 (Deima_2168)
Accession : YP_004171473.1
Strain : Deinococcus maricopensis DSM 21211
Genome accession: NC_014958
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2340843 - 2341418 bp
Length : 576 bp
Strand : -
Note : COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and cAMP-binding protein CABP1; InterPro IPR003325; KEGG: aci:ACIAD1955 tellurium resistance protein; PFAM: Bacterial stress protein; SPTR: tellurium resistance protein; PF

DNA sequence : 
ATGCCCGTATCCCTGACCAAAGGCGGCAACGTCAGCCTCACCAAGGAAGCCCCCGGCCTCAAGAAGATCGTCGTGGGTCT
CGGCTGGGACGTCCGCAAGACCGACGGCGCCGACTTCGACCTGGACGCCATGGTGTTCCTCGTGAACGACCAAGGCAAGG
TCCGCAGCGACGCCGACTTCGTGTTCTTCAACAACAAGCAGAGCGCGGACGGCACCGTCGTCCACGCCGGCGACAACCGC
ACCGGCGCCGGCGAGGGCGACGACGAAACCATCCAGATCAACCTGGAGAGCGTCGCCGCCGACGTGCAGAAAATCGTCAC
GGCCGTCGTCATCTACGACGGTCCCAACCGCAAGCAGAACTTCGGCATGGTCGAACGCGCCTACATCCGCGTGCTGAACG
GCGACGGCGGCACCGAAATCGCCCGCTACGACCTCACCGAGGACGGCGGCACCGTCACCGCCATGATCTTCGGCGAGGTG
TACCGCCACAACGGCGAGTGGAAGTTCAAGGCCATCGGACAGGGGTACGACGCGGGCTTCGAAGCCCTCGTCCGCAGCTA
CGGCGTCAACGCCTGA

Protein sequence : 
MPVSLTKGGNVSLTKEAPGLKKIVVGLGWDVRKTDGADFDLDAMVFLVNDQGKVRSDADFVFFNNKQSADGTVVHAGDNR
TGAGEGDDETIQINLESVAADVQKIVTAVVIYDGPNRKQNFGMVERAYIRVLNGDGGTEIARYDLTEDGGTVTAMIFGEV
YRHNGEWKFKAIGQGYDAGFEALVRSYGVNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-57 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 62
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-58 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deima_2168 YP_004171473.1 stress protein BAC0390 Protein 1e-57 63
Deima_2168 YP_004171473.1 stress protein BAC0389 Protein 2e-58 61