Gene Information

Name : Celal_1386 (Celal_1386)
Accession : YP_004164197.1
Strain : Cellulophaga algicola DSM 14237
Genome accession: NC_014934
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1601208 - 1601762 bp
Length : 555 bp
Strand : -
Note : COGs: COG2310 Uncharacterized protein involved in stress response homologs of TerZ and cAMP-binding protein CABP1; InterPro IPR003325; KEGG: phe:Phep_1939 stress protein; PFAM: Bacterial stress protein; SPTR: Tellurium resistance protein TerD; PFAM: Bacte

DNA sequence : 
ATGGCAATTAATTTACAAAAAGGACAAAGAGAGTCTTTAAGTACAGGAAATTTTACAGTAGGTTTAGGATGGGATACCAA
TGAAACAGCAACAGGTGTTGATTTTGATCTAGATGCCTCAATTTTTATTTTAGGAGAAAATAAAAAACTACTTTCAGAAA
GTCATTTTATTTTTTACAATAATTTAAAGAGTCCAGATGGTTCAGTAGAACATACAGGAGATAATAGAACAGGAGAAGGA
GATGGTGATGATGAGTCTATAATTATAGATTTAACGAAGATAGATACTAATGCCACAGAAATATGTATCGTTGTAACTAT
AGATGACTGTGAGGCGCGTAAACAGAATTTTGGACAAGTTAGAAATTCATTTGTACGTATTGTTGATAATTCTAATAATT
CTGAAGTAATGAAATTTGAATTAGATGAGGATTTTTCTATAGAGACTGCTGTTGAATTTGGTAGAATTTATAAGAAAAAT
AACGAATGGAAATTTGAAGCTATTGGGACAGGTATGAAAGGTGGTCTTCAAGATTTTCTAAATAAATACAATTAA

Protein sequence : 
MAINLQKGQRESLSTGNFTVGLGWDTNETATGVDFDLDASIFILGENKKLLSESHFIFYNNLKSPDGSVEHTGDNRTGEG
DGDDESIIIDLTKIDTNATEICIVVTIDDCEARKQNFGQVRNSFVRIVDNSNNSEVMKFELDEDFSIETAVEFGRIYKKN
NEWKFEAIGTGMKGGLQDFLNKYN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-35 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-35 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-35 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-34 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-34 53
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-38 52
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-34 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-34 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celal_1386 YP_004164197.1 stress protein BAC0390 Protein 5e-38 54
Celal_1386 YP_004164197.1 stress protein BAC0389 Protein 7e-35 52