Gene Information

Name : Varpa_5923 (Varpa_5923)
Accession : YP_004158186.1
Strain : Variovorax paradoxus EPS
Genome accession: NC_014931
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6443032 - 6443706 bp
Length : 675 bp
Strand : +
Note : KEGG: vap:Vapar_5197 two component transcriptional regulator winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGCGAATACTGATTGCCGAAGACGACCAGGTGCTCGCCGATGCCCTGCTGCGCAGCCTGCGCACCTCGGGTGCGGCGGT
CGACCACGTGGCCAACGGCTCGCAGGCCGACACCGCGCTCATGACACACAGCGAGTTCGACCTGCTCATCCTCGACCTGG
GCCTGCCCAGCCTGCACGGCATCGAGATCCTCAAGCGCCTGCGCGCCCGCGGCTCGCAACTGCCCGTGCTGGTGCTGACC
GCCGCCGACAGCGTCGAGGAGCGCGTCAAGGGCCTGGACCACGGCGCCGACGACTACATGGCCAAGCCCTTCAGCCTGCA
GGAACTCGAAGCGCGCGTGCGCGCCCTCACCCGCCGCGGCATGGGCGCCACCAGCAACGCGATCCGCCATGGCCCGCTGG
TCTACGACCAGGCCGGCCGCGTGGCGACCATCGACGGCAAGATGATCGAGCTCTCGGCCCGCGAACTCGGCCTGCTCGAA
GTGCTGCTGCAGCGCGCCGGCCGGCTGGTGAGCAAGGACCAGCTGGTCGACCGTCTGTGCGAATGGGGCGAAGAGGTGAG
CCTCAACGCGATCGAGGTCTACATCCACCGTCTGCGCAAGAAGATCGAGAAGGGCCCGGTGCGCATCGCGACGGTTCGCG
GACTGGGTTATTGCCTCGAAAAAATCCCGGGCTGA

Protein sequence :
MRILIAEDDQVLADALLRSLRTSGAAVDHVANGSQADTALMTHSEFDLLILDLGLPSLHGIEILKRLRARGSQLPVLVLT
AADSVEERVKGLDHGADDYMAKPFSLQELEARVRALTRRGMGATSNAIRHGPLVYDQAGRVATIDGKMIELSARELGLLE
VLLQRAGRLVSKDQLVDRLCEWGEEVSLNAIEVYIHRLRKKIEKGPVRIATVRGLGYCLEKIPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-34 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-29 46
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-30 44
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-22 44
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-25 42
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-25 41
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 2e-25 41
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-27 41
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 8e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-29 42
Varpa_5923 YP_004158186.1 winged helix family two component transcriptional regulator VFG0473 Protein 3e-32 42