Gene Information

Name : Varpa_4082 (Varpa_4082)
Accession : YP_004156365.1
Strain : Variovorax paradoxus EPS
Genome accession: NC_014931
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4405584 - 4406261 bp
Length : 678 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: vap:Vapar_3559 two component heavy metal response transcriptional regulator winged helix family; SMART: response regulat

DNA sequence : 
ATGAGAATCCTTGTCATAGAAGACGAACCCAAACTGGGCGATTACCTCAAAAAAGGGCTGGAGGAAAACGGATATGTCGT
CGACATTGCCCGCGACGGCATCGAGGGCCGATACCTCGCCACCGAGGGAGAGTACGCACTGGTCCTGCTCGACGTCATGC
TGCCCGGCATCGACGGCTTCACAGTGCTCCAGGCGATACGCCGCACGAAGAACGTGCCCGTGCTGGTGCTCACCGCACGC
GACAAAGTCGAAGACCGCGTGCAGGGCCTGCAGCAAGGCGCCGACGATTACCTCGTCAAGCCCTTCTCCTTCTCCGAGTT
GCTGGCGCGCGTGCAGGCGCTGCTTCGGCGCGGCAAGGCACAAGATTCCACCGTGCTGCGCCTTGCCGACCTCGAACTCG
ACATGGCGAGCCGCAAGGTGTTTCGCAACCGCGTGCGGCTCGACCTCACGGCCAAGGAGTTCACCCTGCTGGTGGTGCTG
CTGCGCCGGCGCGGCCAGATCCTCTCGCGCACCACGCTCGCCGAGCAGGTGTGGGACATGAACTTCGACAGCGACACCAA
CGTGGTGGAAGTAGCCATCCGGCGCCTGCGCAGCAAGATCGACGATCCGTTCGAGGTGAAGCTGCTGCACACGGTGCGCG
GCATGGGCTACGTGCTGGAAGACCGCTCCTGGGCATGA

Protein sequence : 
MRILVIEDEPKLGDYLKKGLEENGYVVDIARDGIEGRYLATEGEYALVLLDVMLPGIDGFTVLQAIRRTKNVPVLVLTAR
DKVEDRVQGLQQGADDYLVKPFSFSELLARVQALLRRGKAQDSTVLRLADLELDMASRKVFRNRVRLDLTAKEFTLLVVL
LRRRGQILSRTTLAEQVWDMNFDSDTNVVEVAIRRLRSKIDDPFEVKLLHTVRGMGYVLEDRSWA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-54 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-54 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 4e-66 65
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 3e-55 62
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 1e-67 61
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 1e-58 59
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 1e-56 55
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 3e-59 55
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 4e-52 51
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 5e-32 42
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 2e-32 42
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 4e-55 56
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 3e-36 47
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 5e-42 44
Varpa_4082 YP_004156365.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 3e-33 41