Gene Information

Name : SPSINT_0857 (SPSINT_0857)
Accession : YP_004149021.1
Strain : Staphylococcus pseudintermedius HKU10-03
Genome accession: NC_014925
Putative virulence/resistance : Unknown
Product : Resolvase/integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG1961
EC number : -
Position : 900932 - 901327 bp
Length : 396 bp
Strand : -
Note : -

DNA sequence :
ATGGCTAAAATTGGTTATGCACGTGTATCAACACAAGATCAAAGTTTAGACGGACAAATAGATACACTTGAAGAATATGG
TTGTGAACGTATCTTTAGTGAGAAAGCAAGTGGATGTAAAACAAAAAGAACGGAACTTGATAAATGTTTAGATTATTTAC
GTGAAGGCGATGTGTTGGTTATTTACAAACTCGATCGTCTTGGTCGTACAACGAAACAACTCATCGAACTTTCTCAATGG
TTGGACGAAAATAACATCGATTTACATATTATTGATATGAACGTATCGACCAAAGATGCGATGGGAAAAATGTTCTTTAC
CATGATGAGTGCATTTGCGGAACTTGAAGCTAACTTATTAAGTGAACGTACAAAACCTTTTTCTTTTAACGTATAA

Protein sequence :
MAKIGYARVSTQDQSLDGQIDTLEEYGCERIFSEKASGCKTKRTELDKCLDYLREGDVLVIYKLDRLGRTTKQLIELSQW
LDENNIDLHIIDMNVSTKDAMGKMFFTMMSAFAELEANLLSERTKPFSFNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
resX ADZ05759.1 invertase/resolvase Not tested AbaR10 Protein 7e-22 46
ACICU_00231 YP_001844890.1 site-specific recombinase, DNA invertase Pin protein Not tested AbaR20 Protein 1e-21 46
resX ACN81037.1 partial invertase/resolvase Not tested AbaR5 Protein 1e-21 46
1_365 CAJ77091.1 Resolvase N-term Not tested AbaR1 Protein 1e-21 46
resX ADZ05753.1 invertase/resolvase Not tested AbaR10 Protein 1e-21 46
resX ADZ05809.1 invertase/resolvase Not tested AbaR20 Protein 1e-21 46
resX AGK36651.1 partial invertase/resolvase Not tested AbaR26 Protein 1e-21 46
tnpRN YP_001800927.1 resolvase of Tn5393-like transposon, N-terminal fragment Not tested Not named Protein 3e-12 44