Gene Information

Name : Psesu_0877 (Psesu_0877)
Accession : YP_004145960.1
Strain : Pseudoxanthomonas suwonensis 11-1
Genome accession: NC_014924
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 981505 - 981927 bp
Length : 423 bp
Strand : +
Note : KEGG: pol:Bpro_2219 arsenate reductase; TIGRFAM: arsenate reductase; PFAM: arsenate reductase

DNA sequence : 
ATGAGCGCGATCACGATCTACCACAACCCCCGCTGCGGCACCTCGCGCAACACCCTGGCGATGATCCGCAACAGCGGCGT
CGAGCCGGAGGTCATCGAATACCTGCAGCACCCGCCGACCCTGGAGCGCCTGCGGGAACTTGCCGCGGCCGCGGGCGTGG
GCGTGCGCGGCCTGCTGCGGGCCAAGGAGCCGCTGTGCGCGGAACTGGGCCTGGACGATGCATCGCTGGATGACGAAACG
CTGCTGCAGGCGATGGTCGCCAATCCCGTGCTGATCAACCGCCCGGTGGTGGTGACCCCGCTGGGCACGCGCCTGTGCCG
GCCCTCGGAGGTGGTGCTGGAAATTCTTCCCGATCCCCAGCGCGGCGCCTTCAGCAAGGAGGATGGCGAGGCGGTGGTAG
GTGCCGATGGCCGGCGGGTCTGA

Protein sequence : 
MSAITIYHNPRCGTSRNTLAMIRNSGVEPEVIEYLQHPPTLERLRELAAAAGVGVRGLLRAKEPLCAELGLDDASLDDET
LLQAMVANPVLINRPVVVTPLGTRLCRPSEVVLEILPDPQRGAFSKEDGEAVVGADGRRV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 2e-32 62
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 4e-31 57
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 3e-31 57
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 4e-31 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psesu_0877 YP_004145960.1 arsenate reductase BAC0585 Protein 4e-34 63
Psesu_0877 YP_004145960.1 arsenate reductase BAC0584 Protein 3e-35 63
Psesu_0877 YP_004145960.1 arsenate reductase BAC0583 Protein 3e-34 61
Psesu_0877 YP_004145960.1 arsenate reductase BAC0582 Protein 6e-34 60