Gene Information

Name : Psesu_2539 (Psesu_2539)
Accession : YP_004147602.1
Strain : Pseudoxanthomonas suwonensis 11-1
Genome accession: NC_014924
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2787068 - 2787751 bp
Length : 684 bp
Strand : -
Note : KEGG: xal:XALc_0245 probable two-component system regulatory protein PhoP; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGCGAATCCTTCTGGTCGAAGACGAGGCCCCGCTGCGGGAGACCCTCGCCGCCCGCCTCAAGCGCGAGGGCTTCGCGGT
TGATGCCGCGCAGGATGGCGAGGAAGGCCTCTACATGGGACGCGAGGTCCCGTTCGACGTGGCGATCATTGACCTGGGCC
TGCCCAAGATGTCGGGCATGGAGCTGATCAAGGCGCTGCGCGACGAGGGCAAGAACTTCCCGGTGCTGATCCTCACCGCC
CGCTCGAGCTGGCAGGACAAGGTCGAGGGCCTCAAGCAGGGCGCCGACGACTACCTGGTCAAGCCGTTCCACGTCGAAGA
GCTGCTGGCGCGCCTGAACGCGCTGGTGCGCCGCGCCGCGGGCTGGAGCAAGCCGGTGCTGGAGTGCGGCCCGGTCGCGC
TGGACCTCGCCGCGCAGACGGTCACCGTCAGCGGCAGCAACGTCGACCTGACCAGCTACGAGTACAAGGTCCTCGAGTAC
CTGATGATGCACGCCGGCGAGCTGGTCTCGAAGGCCGACCTCACCGAGCACATCTACCAGCAGGACTTCGACCGCGACTC
CAACGTGCTCGAGGTCTTCATCGGCCGCCTGCGCAAGAAGCTGGATCCGGAAGGCGAGCTCAAGCCGATCGAGACCGTGC
GTGGCCGCGGCTACCGCTTCGCGATCCCGCGCACCGACGGCTGA

Protein sequence :
MRILLVEDEAPLRETLAARLKREGFAVDAAQDGEEGLYMGREVPFDVAIIDLGLPKMSGMELIKALRDEGKNFPVLILTA
RSSWQDKVEGLKQGADDYLVKPFHVEELLARLNALVRRAAGWSKPVLECGPVALDLAAQTVTVSGSNVDLTSYEYKVLEY
LMMHAGELVSKADLTEHIYQQDFDRDSNVLEVFIGRLRKKLDPEGELKPIETVRGRGYRFAIPRTDG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-54 57
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 7e-39 45
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator BAC0530 Protein 7e-39 45
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 5e-38 44
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 2e-39 44
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 7e-40 44
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 2e-37 43
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 2e-38 43
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator BAC0487 Protein 9e-22 41
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-26 41
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psesu_2539 YP_004147602.1 winged helix family two component transcriptional regulator VFG0475 Protein 2e-39 44