Gene Information

Name : Psesu_1567 (Psesu_1567)
Accession : YP_004146643.1
Strain : Pseudoxanthomonas suwonensis 11-1
Genome accession: NC_014924
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1727887 - 1728324 bp
Length : 438 bp
Strand : -
Note : TIGRFAM: Cu(I)-responsive transcriptional regulator; PFAM: transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: mpt:Mpe_A3534 MerR family transcriptional regulator; SMART: regulatory protein MerR

DNA sequence : 
GTGAGCCGCGGCGCGAAGGCACCCGCGGCAGGCGACGGCCTGCATTCCATAGGCGAGGCCGCTGCACGCTCGGGCGTGTC
CGCCAAGATGATCCGCCACTACGAGGAGATCGGCCTGGTCCCGCCGCCGCCGCGCACGGCTGCCGGCTACCGGCTGTACG
CCGAAGCCGATGTGCACCGCCTGCGCTTCATCAGCCGGGCGCGGGCGCTGGGTTTTGGCATGAAGCAGATCGGCCTGCTG
CTGGCGCTGTGGTCGGACCGTTCCCGCGCCAGCGCCGATGTCAGGCAGCTCGCGCTGCAACACGCGGCCGAACTGGGCGA
GCGCATCGCCCAGATGCAGGCGATGCAGCGCACCCTGGAGGCGCTGGCCAGCCAGTGCCACGGCGATGAGCGGCCGGAGT
GTCCGATCCTCGATGATCTGGAAGGGAGGTGCGGCTAG

Protein sequence : 
MSRGAKAPAAGDGLHSIGEAAARSGVSAKMIRHYEEIGLVPPPPRTAAGYRLYAEADVHRLRFISRARALGFGMKQIGLL
LALWSDRSRASADVRQLALQHAAELGERIAQMQAMQRTLEALASQCHGDERPECPILDDLEGRCG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psesu_1567 YP_004146643.1 MerR family transcriptional regulator BAC0190 Protein 1e-38 62
Psesu_1567 YP_004146643.1 MerR family transcriptional regulator BAC0182 Protein 4e-32 56
Psesu_1567 YP_004146643.1 MerR family transcriptional regulator BAC0569 Protein 5e-31 50
Psesu_1567 YP_004146643.1 MerR family transcriptional regulator BAC0105 Protein 2e-25 41