
|
Name : Mesci_3844 (Mesci_3844) Accession : YP_004143011.1 Strain : Mesorhizobium ciceri WSM1271 Genome accession: NC_014923 Putative virulence/resistance : Virulence Product : prophage CP4-57 regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3975877 - 3976080 bp Length : 204 bp Strand : + Note : PFAM: prophage CP4-57 regulator; KEGG: kpe:KPK_1789 transcriptional regulator, AlpA family DNA sequence : ATGCGCACCACAAATACTTTCATAAGGCGCCCAGATGTCGAAAGACTAACCGGGCTGAAGACCAGTTCGCTCTACGAGCA GATGAAGGAGGGGAATTTTCCCCGGCCGATTAAAATCGGGGCGAAGGCAGTCGCGTGGAGACTCGCTGACGTGACCGAAT GGCAAGAACGCAAGATCGCCCAGCGCGACAGCGCTGCGGCGTGA Protein sequence : MRTTNTFIRRPDVERLTGLKTSSLYEQMKEGNFPRPIKIGAKAVAWRLADVTEWQERKIAQRDSAAA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 3e-09 | 47 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 5e-09 | 47 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 7e-07 | 45 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 42 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 42 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Mesci_3844 | YP_004143011.1 | prophage CP4-57 regulator | VFG1141 | Protein | 6e-07 | 42 |