Gene Information

Name : GYMC52_3572 (GYMC52_3572)
Accession : YP_004134055.1
Strain : Geobacillus sp. Y412MC52
Genome accession: NC_014915
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3605017 - 3605730 bp
Length : 714 bp
Strand : -
Note : KEGG: gyc:GYMC61_3538 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGGAAAAACGCATTTTAGTCGTTGATGATGAAAAACCGATTGCCGATATTTTGCAATTTAATTTGCAAAAAGAAGGATA
TGAAGTCATTTGCGCCTACGACGGCGAAGAAGCGCTGCAAAAAGTTGAAGAAACGATGCCGGACTTGATTTTATTGGATA
TTATGTTGCCGTTAAAAGATGGCATGGAAGTATGCCGTGAAGTGCGGAAAAAGTATGATATGCCGATCATTATGCTGACA
GCGAAAGATTCCGAGATTGATAAAGTGCTTGGGTTGGAGCTTGGTGCGGACGATTATGTGACAAAGCCGTTCAGCACGCG
CGAGCTCCTGGCGCGGGTGAAGGCAAACTTGCGCCGCCATGCGCAAACGGCCAACCAAGAAGAAGGAGAAAACGAAACAA
ATGAAATTGTCATTGGCCCGCTCGTCATCCGTCCGGACGCGTATATTGTGCAAAAGCGCGGCGAAACGATTGAACTGACC
CACCGCGAATTTGAGCTGCTTCATTATTTGGCGAAGCACATTGGCCAAGTGATGACGCGCGAGCATTTGCTGCAAACCGT
TTGGGGCTACGACTATTATGGAGATGTGCGCACCGTTGACGTGACGGTAAGGCGTCTGCGTGAAAAAATTGAGGACAACC
CTTCCCACCCGAATTGGATCGTCACAAGGCGAGGCGTCGGCTATTACTTGCGCAATCCAGAACAGGAGTCATGA

Protein sequence :
MEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEETMPDLILLDIMLPLKDGMEVCREVRKKYDMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHAQTANQEEGENETNEIVIGPLVIRPDAYIVQKRGETIELT
HREFELLHYLAKHIGQVMTREHLLQTVWGYDYYGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-20 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-27 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-56 66
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-48 56
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-48 55
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 4e-39 53
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-36 50
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 7e-34 47
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-38 46
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-24 45
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 3e-34 45
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 9e-30 45
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-28 44
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 3e-29 43
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-28 43
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 4e-33 43
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 4e-33 43
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 2e-33 43
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 1e-32 43
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-29 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 6e-31 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 6e-31 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 7e-30 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 3e-32 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family BAC0533 Protein 3e-32 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 3e-32 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 2e-20 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-24 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-24 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 5e-32 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 3e-26 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 3e-26 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family BAC0039 Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family VFG1389 Protein 9e-24 44
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family VFG1390 Protein 9e-27 42
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family VFG1702 Protein 9e-28 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family VFG1563 Protein 7e-28 41
GYMC52_3572 YP_004134055.1 two component transcriptional regulator, winged helix family VFG1386 Protein 8e-25 41