Name : Alide_4501 (Alide_4501) Accession : YP_004129079.1 Strain : Genome accession: NC_014911 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic component Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 72194 - 72469 bp Length : 276 bp Strand : - Note : KEGG: enc:ECL_A234 mercury ion transport protein periplasmic component MerP; TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGAAAAAGCTGCTTTCCGCCCTTGCCCTCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTTACGCTGTC CGTACCGGGCATGACCTGCTCGGCCTGTCCGATCACTGTCAAGAAGGCGATTTCCAAGGTCGATGGCGTCAGTAAAGTTG ACGTGACCTTCGAGACGCGCGAAGCGGTGGTCACCTTCGATGATGCCAAGACCAGCGTGCAGAAACTGACCAAGGCTACC GAGGATGCGGGCTACCCATCATCAGTCAAGAACTGA Protein sequence : MKKLLSALALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVDGVSKVDVTFETREAVVTFDDAKTSVQKLTKAT EDAGYPSSVKN |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 5e-22 | 85 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 5e-22 | 85 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 5e-22 | 85 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 5e-22 | 85 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 5e-22 | 85 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 7e-22 | 85 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-21 | 82 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-21 | 82 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-21 | 79 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Alide_4501 | YP_004129079.1 | mercuric transport protein periplasmic component | BAC0231 | Protein | 5e-24 | 96 |
Alide_4501 | YP_004129079.1 | mercuric transport protein periplasmic component | BAC0679 | Protein | 1e-23 | 96 |
Alide_4501 | YP_004129079.1 | mercuric transport protein periplasmic component | BAC0678 | Protein | 1e-23 | 94 |
Alide_4501 | YP_004129079.1 | mercuric transport protein periplasmic component | BAC0675 | Protein | 5e-19 | 72 |
Alide_4501 | YP_004129079.1 | mercuric transport protein periplasmic component | BAC0674 | Protein | 4e-15 | 60 |