Gene Information

Name : Alide_0232 (Alide_0232)
Accession : YP_004124903.1
Strain : Alicycliphilus denitrificans BC
Genome accession: NC_014910
Putative virulence/resistance : Resistance
Product : cd(ii)/pb(ii)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 259708 - 260163 bp
Length : 456 bp
Strand : +
Note : SMART: regulatory protein MerR; manually curated; TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; KEGG: mpt:Mpe_A1657 transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR

DNA sequence : 
ATGAAAATCGGCGAACTGGCTAAGGCCGCACATACCCAGGTAGAGACGATCCGGTACTACGAGCGTGAAGGCTTGCTACC
AGAAACGGCCCGTACAGATGGCAACTACCGCATGTACGCAGAAGAACACGTTGACCGACTGTCCTTCATCCGGCACTGCC
GGGGTTTGGACATGACACTGGATGAAATCCGGGTTCTATTGCGCTTCAAGGATGCTCCGCACGAGAACTGCGCCCAGGTG
AATGACCTGCTCGACGAGCACATCGACCATGTGGCTACCCGCATCAAGGAATTGAAAGCGTTGGAACGACAGCTCAAGAC
CTTGCGGGAAAGCTGCCGGGAATCCCAGCAGGCCAGCCAGTGCGGCATCTTGACCGAACTGTCCTCAGCATCGCGCCAGG
TGCACGAGCCAGCAACGCGCAGGGGTCATGTTCATGGGGCACATAGCCTCAAGTGA

Protein sequence : 
MKIGELAKAAHTQVETIRYYEREGLLPETARTDGNYRMYAEEHVDRLSFIRHCRGLDMTLDEIRVLLRFKDAPHENCAQV
NDLLDEHIDHVATRIKELKALERQLKTLRESCRESQQASQCGILTELSSASRQVHEPATRRGHVHGAHSLK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 2e-35 55
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-36 49
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 4e-36 49
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-36 49
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 2e-36 49
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-36 49
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-36 49
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-36 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide_0232 YP_004124903.1 cd(ii)/pb(ii)-responsive transcriptional regulator BAC0058 Protein 1e-40 58
Alide_0232 YP_004124903.1 cd(ii)/pb(ii)-responsive transcriptional regulator BAC0301 Protein 9e-34 57
Alide_0232 YP_004124903.1 cd(ii)/pb(ii)-responsive transcriptional regulator BAC0682 Protein 7e-22 42