Gene Information

Name : Pat9b_4111 (Pat9b_4111)
Accession : YP_004119645.1
Strain :
Genome accession: NC_014842
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 105124 - 105471 bp
Length : 348 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: eoj:ECO26_5474 hypothetical protein

DNA sequence : 
GTGATTAACTTTCCGGCTGGCTCGCGCATCTGGCTGGTCGCCGGTGTGACGGATATGCGCTGCAGCTTTAACGGGCTGGC
AGCGAAAGTGCAGAACACGCTGCGTACTGACCCGTTCAGCGGGCACCTGTTTATCTTTCGCGGGCGACGGGGCGACATGA
TAAAGGTGCTGTGGGCTGACCGGGATGGACTGTGCCTGTTCACCAAACGGCTGGAACGCGGGCGCTTCGTGTGGCCGGTA
ACCCGCGACGGTAAAGTCCATCTGACGCCGGCGCAGCTGGGCATGTTGCTGGAGGGCATTAACTGGAAACATCCGCAGCG
GACGGAACGCCCTGGTCTGCGCATCTGA

Protein sequence : 
MINFPAGSRIWLVAGVTDMRCSFNGLAAKVQNTLRTDPFSGHLFIFRGRRGDMIKVLWADRDGLCLFTKRLERGRFVWPV
TRDGKVHLTPAQLGMLLEGINWKHPQRTERPGLRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-45 87
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-45 87
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-45 87
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-45 79
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-45 79
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-36 72
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-36 72
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-36 71
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-35 70
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-35 70
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-35 70
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-35 70
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-34 70
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-35 70
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-34 70
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-35 70
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-35 70
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-35 70
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 6e-27 69
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-36 65
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-36 65
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-35 63
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-34 63
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-34 63
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-31 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pat9b_4111 YP_004119645.1 IS66 Orf2 family protein VFG1665 Protein 1e-45 87
Pat9b_4111 YP_004119645.1 IS66 Orf2 family protein VFG1698 Protein 1e-36 72
Pat9b_4111 YP_004119645.1 IS66 Orf2 family protein VFG1052 Protein 3e-36 71
Pat9b_4111 YP_004119645.1 IS66 Orf2 family protein VFG0792 Protein 5e-36 70
Pat9b_4111 YP_004119645.1 IS66 Orf2 family protein VFG1709 Protein 5e-36 70
Pat9b_4111 YP_004119645.1 IS66 Orf2 family protein VFG1517 Protein 3e-27 69
Pat9b_4111 YP_004119645.1 IS66 Orf2 family protein VFG1737 Protein 3e-36 63