Gene Information

Name : Pat9b_5763 (Pat9b_5763)
Accession : YP_004118475.1
Strain :
Genome accession: NC_014838
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 638394 - 639098 bp
Length : 705 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: dar:Daro_2259 two component heavy metal response transcriptional regulator; SMART: response regulator receiver

DNA sequence : 
ATGAGATTATTGTTGGTGGAAGATCAAACCACGGCGGCGGACTACATCGCCAAAGGCTTGCGGGAGAATGATTTTGTCGT
CGACGTTGCCGCGAATGGCGTCGATGGACTGCATTTGTTGCTGACTCATGAGTATGATCTGGCGATTCTCGACGTGATGT
TACCCGGCATTAATGGCTGGAAACTGCTGGAAATGGCCCGCCAGGCGGACAGAAAAACCCCGGTGATGTTTTTAACCGCG
CGCGATGATGTTGAGGACCGCGTGCGTGGGCTGGAACTGGGTGCCGAAGATTACCTGATCAAACCCTTTTCCTTCAGCGA
GCTGCTGGCGCGAACCCGGGTTATTTTACGTCGTCAGACGCCGGGAAATGTCACTGTCAGCGACGAATCCCAGTTGCAGA
TTGGCGATCTGTTGCTGGACTTCGTCAAGCATAAAGTCACCCGTGCGGGTAACCGTATCGACCTGACACAAAAAGAGTTT
CTGCTGCTGAGCCTGCTGATGCGCCGTAGCGGCGAAGTGCTGTCGCGCACCGTGATTGCGGAACAGGTGTGGGACATGAA
TTTCGACCCGGAAACCAATGTGATCGATGTCGCCATCCGCCGTCTGCGCAGTAAAATTGATGACAACTACGAGATGAAAC
TGCTGCACACCATTCGGGGTGCCGGATATGTGCTGGAAGAAAAAGAGCATGCTGATACCCCGTAA

Protein sequence : 
MRLLLVEDQTTAADYIAKGLRENDFVVDVAANGVDGLHLLLTHEYDLAILDVMLPGINGWKLLEMARQADRKTPVMFLTA
RDDVEDRVRGLELGAEDYLIKPFSFSELLARTRVILRRQTPGNVTVSDESQLQIGDLLLDFVKHKVTRAGNRIDLTQKEF
LLLSLLMRRSGEVLSRTVIAEQVWDMNFDPETNVIDVAIRRLRSKIDDNYEMKLLHTIRGAGYVLEEKEHADTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-58 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-57 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-63 59
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-66 58
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-63 58
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-66 57
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-59 56
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-58 55
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family BAC0308 Protein 6e-60 53
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-35 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-30 42
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-58 52
Pat9b_5763 YP_004118475.1 two component transcriptional regulator, winged helix family VFG1386 Protein 6e-36 41