Gene Information

Name : Selin_0015 (Selin_0015)
Accession : YP_004111330.1
Strain : Desulfurispirillum indicum S5
Genome accession: NC_014836
Putative virulence/resistance : Resistance
Product : Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 13078 - 13485 bp
Length : 408 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: abo:ABO_1367 MerR family transcriptional regulator; SMART: regulatory protein MerR

DNA sequence :
ATGCGCATTGGTCAGTTGGCGCAGTTGGTAGGGGTCGAAACACAGACGATCCGCTTCTATGAACAGCAGGGCTTGTTGCC
GCCGCCTGATCGGCAGGTCAACGGTTACCGTGTCTATACCGAGAAGCATGGTGAGGGGCTGGCCTTCATCCGTCGCTGCA
GAATCCTGGGCCTGTCACTGGCTGAGATTCACGAACTACAGAGCTATGAGGACGACCCTCATCAGCCTTGTACCGCCGTC
AACGCCTTGCTCGATGATCACATCTCTCATGTGCGGTCGCAGATAACCGCTCTGCAAGCGCTTGAGAAACAACTCGTTTC
ACTGAGAGCGAGTTGCAACGATGACCGGGAAGTTGAGGCGTGTGGGGTTCTTGCTGGAATTAGCGAAGGAAACATGCACC
AGCAGTAG

Protein sequence :
MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQVNGYRVYTEKHGEGLAFIRRCRILGLSLAEIHELQSYEDDPHQPCTAV
NALLDDHISHVRSQITALQALEKQLVSLRASCNDDREVEACGVLAGISEGNMHQQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 1e-53 90
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 7e-54 90
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 7e-54 90
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-53 90
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 2e-53 89
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-53 89
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-53 89
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 1e-28 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selin_0015 YP_004111330.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 2e-23 47
Selin_0015 YP_004111330.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 1e-27 46