Gene Information

Name : Rpdx1_3587 (Rpdx1_3587)
Accession : YP_004109889.1
Strain : Rhodopseudomonas palustris DX-1
Genome accession: NC_014834
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3846828 - 3847502 bp
Length : 675 bp
Strand : -
Note : KEGG: nha:Nham_1433 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence : 
GTGCGTCTGCTCGTCGTCGAAGATGACCCCGATCTCAACCGCCAGCTCACCACCGCGCTGACCGACGCCGGTTACGTCGT
CGACCGCGCCTTCGACGGCGAGGAGGGGCACTTCCTCGGCGACACCGAGCCCTACGACGCGGTGGTGCTCGACATCGGCC
TGCCGAAGATGGACGGCATCTCGGTGCTGGAGGCGTGGCGGCGCAACAGCCGGGCGATGCCGGTGCTGATCCTGACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAGGGCTTCGACGCCGGCGCCGACGACTACGTCGCCAAGCCGTTTCACCTCGAAGA
GGTGCTGGCGCGGATCCGGGCGCTGCTGCGGCGGAGCGCCGGCCACGCCCAGTCCGAACTGAGCTGCGGTCCGGTGGTGC
TCGACACCCGCACCGGCCGGGTCAGCGCCAATGGCAATCCGGTCAAGCTGACCAGCCACGAATATCGGCTGCTCGCCTAT
CTGATGCACCACTCCGGCCGGGTGGTGTCGCGCACCGAACTGGTCGAGCATCTGTACGACCAGGATTTCGACCGCGACAG
CAACACGATCGAAGTGTTCGTCGGCCGCATCCGCAAGAAGCTCGGCGTCGACATCATCCAGACCGTGCGCGGGCTCGGCT
ATCTGCTGTCGCCGCCGGCCGCGGACGCGCATTAG

Protein sequence : 
MRLLVVEDDPDLNRQLTTALTDAGYVVDRAFDGEEGHFLGDTEPYDAVVLDIGLPKMDGISVLEAWRRNSRAMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHLEEVLARIRALLRRSAGHAQSELSCGPVVLDTRTGRVSANGNPVKLTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLGVDIIQTVRGLGYLLSPPAADAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 6e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-41 49
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 8e-36 46
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator BAC0530 Protein 6e-36 46
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 1e-34 45
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 6e-35 45
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 2e-35 45
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 2e-35 45
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 1e-37 44
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator BAC0487 Protein 4e-30 44
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-27 41
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-31 41
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator VFG0475 Protein 1e-35 45
Rpdx1_3587 YP_004109889.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-28 41