Gene Information

Name : Rpdx1_3571 (Rpdx1_3571)
Accession : YP_004109873.1
Strain : Rhodopseudomonas palustris DX-1
Genome accession: NC_014834
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3827371 - 3828096 bp
Length : 726 bp
Strand : -
Note : KEGG: bbt:BBta_3078 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence : 
ATGTTGCAGCAGAGCCCGCAGAGTTTGAAGAAATCCGACAGCAATATGCGTCTGTTGATCATCGAGGACGACCGCGAATC
CGCCGATTACCTGGTCAAGGCGTTTCGCGAGGTCGGCCACATTGCCGATCTCGCCGGTGACGGCGAAGAGGGGCTGGCGC
TGGCGGAGAGCGGCGATTATGACGTGCTGGTGGTCGACCGGATGCTGCCGAAGCGCGACGGTCTGTCGGTGATCGGCAGC
CTGCGCGACAAGGGCAATCGCACGCCGGTGCTGATCCTGTCCGCGCTCGGTCAGGTCGACGACCGCATCAAGGGCCTGCG
CGCCGGCGGTGACGACTATCTGCCGAAGCCCTACGCCTTCGCCGAACTGCTGGCGCGCGTCGAGGTGCTGTCGCGGCGCC
ACGGCGGCCCGGCGGAGGAAACCAGCTACCGGGTCGGCGACCTCGAACTCGACCGGCTGTCGCACCGCGTCACCCGCGGC
GGCGAAGAGCTGACGTTGCAGCCGCGTGAATTCCGGCTGCTCGAATACCTGATGAAGCACGCCGGCCAGGTGGTGACCCG
CACCATGCTGCTGGAGAACGTCTGGGACTATCACTTCGATCCGCAGACCAACGTCATCGACGTCCACATCTCGCGGCTGC
GCGGCAAGATCGACAAGGGCTTCGACCGCCCGCTGCTGCACACCATCCGCGGCGCCGGCTACATGATCCGCGACGGACTG
CGCTGA

Protein sequence : 
MLQQSPQSLKKSDSNMRLLIIEDDRESADYLVKAFREVGHIADLAGDGEEGLALAESGDYDVLVVDRMLPKRDGLSVIGS
LRDKGNRTPVLILSALGQVDDRIKGLRAGGDDYLPKPYAFAELLARVEVLSRRHGGPAEETSYRVGDLELDRLSHRVTRG
GEELTLQPREFRLLEYLMKHAGQVVTRTMLLENVWDYHFDPQTNVIDVHISRLRGKIDKGFDRPLLHTIRGAGYMIRDGL
R

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-50 48
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-47 48
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-55 48
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-46 46
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator BAC0347 Protein 8e-47 44
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-45 44
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-39 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-34 45
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator VFG0473 Protein 6e-30 41
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-39 41
Rpdx1_3571 YP_004109873.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-40 41