Gene Information

Name : Bcell_4306 (Bcell_4306)
Accession : YP_004097264.1
Strain : Bacillus cellulosilyticus DSM 2522
Genome accession: NC_014829
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4653388 - 4654095 bp
Length : 708 bp
Strand : -
Note : KEGG: two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
GTGGACAAGCAAAAAATTCTCGTTGTTGACGATGAACAACCTATTGCAGATATTTTAAAGTTCGGATTAGAAAAGGATGG
TTATGAGGTTATATGTGCGTACGATGGTAATGAAGCGATAGAGATGACGAACAAACATGAACCAGACCTCATTTTATTAG
ATATTATGCTCCCATATCAAGATGGTATGGAAGTATGTAGGGAAGTACGTAAAAAGTTTGATATGCCTATTATTATGCTA
ACGGCAAAAGACTCGGAGATAGACAAAGTATTAGGGCTAGAGCTAGGGGCAGATGATTATGTGACAAAACCTTTTAGTAC
TCGTGAATTAGTGGCGAGAGTAAAGGCTAATTTAAGAAGAAATCAAAAATCTAAAGAACCAGATACAGAAAAGAAAAACA
TTCAAATCGGAGCATTATTGATCCAGCCAGATGCTTATTTAGTATCCAAGCGTGGTGAGCCAATCGAATTAACGCATAGA
GAGTTTGAGTTAGTCTATTATTTAGCGAAGCATATTGGACAAGTGATGACGAGAGAGCACCTGCTACAGGCTGTATGGGG
GTATGATTACTTTGGGGATGTTCGAACAGTCGATGTTACTGTACGAAGACTACGAGAAAAAGTAGAAGATGACCCGAGTA
ACCCAACGTGGATCATAACGCGTAGAGGAGTAGGTTACTACTTAAGGAATGCTGACCAGGAGAACTAG

Protein sequence :
MDKQKILVVDDEQPIADILKFGLEKDGYEVICAYDGNEAIEMTNKHEPDLILLDIMLPYQDGMEVCREVRKKFDMPIIML
TAKDSEIDKVLGLELGADDYVTKPFSTRELVARVKANLRRNQKSKEPDTEKKNIQIGALLIQPDAYLVSKRGEPIELTHR
EFELVYYLAKHIGQVMTREHLLQAVWGYDYFGDVRTVDVTVRRLREKVEDDPSNPTWIITRRGVGYYLRNADQEN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-64 65
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-54 55
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-55 54
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-47 52
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-40 48
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-35 48
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-38 47
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-41 47
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-44 47
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 4e-38 44
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 5e-31 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-35 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-35 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-33 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-35 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-36 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 8e-33 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-33 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-33 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-32 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-31 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 3e-26 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-29 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-29 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-29 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_010410.6002907.p0 Protein 5e-23 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator NC_011586.7046392.p0 Protein 5e-23 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-26 41
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-28 41
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-34 41
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 6e-35 41
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-28 41
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 7e-28 41
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-28 43
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-27 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-33 42
Bcell_4306 YP_004097264.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-29 41