Gene Information

Name : Bcell_3090 (Bcell_3090)
Accession : YP_004096064.1
Strain : Bacillus cellulosilyticus DSM 2522
Genome accession: NC_014829
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3283282 - 3283680 bp
Length : 399 bp
Strand : -
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: sag:SAG2024 mercuric resistance operon regulatory protein MerR; SMART: regulatory protein MerR

DNA sequence :
ATGGAACTCCTGATAAGTGAACTAGCAGAAAAATGTGGTGTGAATAAAGAAACGATTAGATATTATGAACGTAAAAAGTT
GTTACAACAACCATCTCGAACTCATTCAGGTTACAGAATATATTCAGAAAATGATGTTAAACGAATTAAATTTATTAAAA
GACTGCAAGACCTTGGCTTTTCTTTGGGTGAAATATATAAATTGCTTGGTGTTGTTGATAATGATGAAGTTCGTTGCCGA
GATATGTATAAATTTGTTTCTAAAAAAGAAGAGGAAGTTCAAAAGCACATAGAGGATTTAAAGCGAATTGAAACTATGTT
ACAAGATTTAAAACAGCGATGTCCAGACAGGAAACAATTACATGCTTGTCCAATAATCGAAACATTGATTAAAGACTAA

Protein sequence :
MELLISELAEKCGVNKETIRYYERKKLLQQPSRTHSGYRIYSENDVKRIKFIKRLQDLGFSLGEIYKLLGVVDNDEVRCR
DMYKFVSKKEEEVQKHIEDLKRIETMLQDLKQRCPDRKQLHACPIIETLIKD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 6e-36 57
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 4e-36 57
merR AGK07025.1 MerR Not tested SGI1 Protein 8e-21 43
merR AGK07083.1 MerR Not tested SGI1 Protein 8e-21 43
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-20 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-20 42
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-20 42
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcell_3090 YP_004096064.1 MerR family transcriptional regulator BAC0682 Protein 9e-40 65
Bcell_3090 YP_004096064.1 MerR family transcriptional regulator BAC0680 Protein 5e-36 55
Bcell_3090 YP_004096064.1 MerR family transcriptional regulator BAC0683 Protein 9e-21 41
Bcell_3090 YP_004096064.1 MerR family transcriptional regulator BAC0688 Protein 5e-21 41