Gene Information

Name : Mspyr1_28960 (Mspyr1_28960)
Accession : YP_004077353.1
Strain : Mycobacterium gilvum Spyr1
Genome accession: NC_014814
Putative virulence/resistance : Resistance
Product : cation/cationic drug transporter
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 3005965 - 3006291 bp
Length : 327 bp
Strand : -
Note : PFAM: Small Multidrug Resistance protein

DNA sequence :
GTGACGTGGGTGTTCTTGATTCTGGCGATATCCAGCGAAGTCGCCGCGACACTGTCCCTCAAAGGCTCCGAGACGGTGCC
CGCGTTGTACGCCGTCGTCGTCCTGGGCTATCTCGCCTCGTTCGTCTTCCTCGCCCTCGTCCTCCGCCGGGGTATGGGAC
TCGGCGTCGCATACGGAATCTGGGGCGCTTCCGGTGTCGCGATGACGGCGCTGCTGTCGGCGGTCCTGTTCGGTGAGGAA
TTGACCGCGCTGATGATGGCCGGCCTCGGGTGCATCATCGCCGGCGTGGCGCTGGTCGAGACCGGATCCCGGGTGGACGC
CGAATGA

Protein sequence :
MTWVFLILAISSEVAATLSLKGSETVPALYAVVVLGYLASFVFLALVLRRGMGLGVAYGIWGASGVAMTALLSAVLFGEE
LTALMMAGLGCIIAGVALVETGSRVDAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-11 41
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-11 41
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-11 41
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-11 41
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-11 41
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-11 41
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-11 41
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-11 41
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-10 41
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-11 41
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 41
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-10 41
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 41
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-10 41
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 41
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-10 41
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-11 41
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 41
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-10 41
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-11 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mspyr1_28960 YP_004077353.1 cation/cationic drug transporter BAC0323 Protein 4e-11 41